KEGG   Nasonia vitripennis (jewel wasp): 100119373Help
Entry
100119373         CDS       T01081                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100119373
  Lipid metabolism
   00600 Sphingolipid metabolism
    100119373
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100119373
   00604 Glycosphingolipid biosynthesis - ganglio series
    100119373
   00511 Other glycan degradation
    100119373
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100119373
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100119373
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100119373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 629 aa AA seqDB search
MWTVVGLFITYLLAFSNLAESSEHNIKNYSFAIDYENDQFLLDGKPFRYVSGSFHYFRTP
RQHWRGILRKMRAGGLNAVSTYVEWSMHEPEFDQWVWDGDADIVEFIKIAQEEDLFVILR
PGPYICAERDFGGFPYWLLSRVPDIKLRTKDERYVFYAERFLNEILRRTKPLLRGNGGPI
IMVQVENEYGSFYACDDQYKSKMYEIFHRHVKNDAVLFTTDGSARSMLKCGSIPGVYATI
DFGNGANVPFNYKIMREFSPKGPLVNSEYYPGWLTHWGESFQRVNSHNVAKTLDEMLAYN
VSVNIYMYYGGTNFAFTSGANINEHYWPQLTSYDYDAPLTEAGDPTPKYFELRDVIAKHM
PLPNLKTPAVAPKRGYGVVTMTPKVDLFSKAGRNTFGTVRAEFSKPPTFESLVQNNYLVL
YEADLPLLEKPENVTLDAVTKDRALVYVNNNLAGVLNRMDKTYSLPLTAKNARDIKILVE
NMGHVNFGSIDVEDFKGIFDVKLNGSPLASWKVTGFKLASVVDSDLGVKETSGQTGHLHN
GPQFLEGHFVIDGELFDTYLNTQGWGKGVAYINGFNLGRYWPSLGPQVTLYVPATYLKKG
KNSLVLLEQDYVPQSRTFEFQTKAILDYQ
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggacagttgtgggattatttataacctacttattagcatttagtaatttagcggaa
tcatcggaacataacattaaaaattacagcttcgcaattgattatgaaaatgaccaattt
cttcttgacggaaaaccgtttcgatatgtctccggaagttttcattacttcagaacccca
agacaacattggcgaggcattcttagaaaaatgagagccggcggattgaatgccgtttct
acatacgttgaatggagtatgcacgaacctgaatttgaccagtgggtatgggatggagat
gcggatattgttgaatttattaaaatagcccaggaggaagacttgttcgttatattacga
cccggaccatacatttgcgcggaaagagattttggaggctttccttattggttattatct
cgagtcccggatatcaaattgcgcaccaaagatgaacgatacgtattttatgctgagaga
ttcttaaatgaaattttaagaagaaccaaacctctattgagaggaaacggtgggccaata
attatggtgcaggtagaaaatgaatacggaagcttttacgcatgtgatgatcagtataag
agcaaaatgtatgaaattttccatcgtcatgtcaaaaacgacgcggttttatttacaaca
gatggatcagctagaagcatgctgaaatgtggatctattccgggggtttacgcaacaatc
gattttggaaacggagccaatgtaccattcaactataaaataatgagagaattttcacca
aagggtccgctcgtgaactcagaatattatcctggatggcttacacactggggtgaatcc
ttccaaagagttaactcccacaatgtagcgaaaactctcgatgagatgttggcatacaac
gtatctgtaaatatttacatgtactatggtggaacaaactttgcctttacctctggtgca
aacatcaatgaacattattggccacaactgacttcttatgattacgatgccccactcact
gaagcgggcgatcctacgccaaaatatttcgaattaagagatgtcatagctaagcacatg
ccactgccaaacttgaaaactcctgctgttgctccaaagcgtggttatggtgttgtcact
atgacaccgaaagtcgatctcttttctaaagcaggccgaaatactttcggaactgtgcgg
gctgaattttcaaaaccaccaacattcgaatctttggtccagaacaactacctagtttta
tatgaagctgacttaccattgcttgaaaagcccgagaacgtcacactggatgccgtaacc
aaggacagagctctcgtgtacgtaaacaacaatcttgctggtgttttgaacaggatggac
aaaacttactccctgcctctgaccgctaaaaatgcaagggacattaagattctggtagaa
aacatgggtcacgtgaactttggaagcattgacgttgaggattttaagggtatcttcgac
gtgaaactaaacggttcaccgctagcgtcgtggaaggtcactggattcaagctagcatcc
gttgtcgacagcgatctcggtgtcaaggagacgtccgggcaaactggacacttgcacaac
ggaccacagttcctcgagggtcacttcgtaatcgatggcgaactcttcgatacctacctg
aacacacagggctggggtaagggagtcgcgtacataaatggctttaatctcggtaggtac
tggccatcgttaggaccgcaagttactctttacgttccggccacctatcttaagaagggc
aagaatagtttagtactgctggagcaggactacgtcccacaaagtcgcacctttgagttc
cagacgaaagctattttggattatcagtaa

DBGET integrated database retrieval system