KEGG   Nasonia vitripennis (jewel wasp): 100119448Help
Entry
100119448         CDS       T01081                                 

Definition
polyprenol reductase
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100119448
    1.3.1.94  polyprenol reductase
     100119448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 302 aa AA seqDB search
MTLNLIKIAFIFSACTTGFLGLLINFFEKYLPASLSKIFRYGKFAADIKDAVLDKCEVPK
RWFKHYYAFAGPFSTIAIVMVFYRYFFGGKHADAVQLGLSFLLGKPIRSLVPDENVILAM
TIFTIHCWKRFYESHFVSVYSDQYMNVSLYLLGFFHYFGSVISIVGESQNFLKGTEIDLN
WSRLSMLDWACALIFLVSTYLQYRSNIILSNLRKDKKGVVVTKKHKVPHGGLFNYVTAPL
QLTEIILYLCLSAILRSASTFHFVTLWVLINQMECAYLSHEWSLRKFENYPKSRKIIIPY
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactctgaatctaataaagatcgcgtttatatttagcgcgtgcactactggctttctc
ggcctgctgattaactttttcgagaagtacctgccagcctcgttatctaagatcttcagg
tacggcaagtttgctgccgacatcaaggatgctgtacttgataagtgcgaggtgcccaaa
agatggttcaagcactactatgcgtttgctgggccgttttctaccatagcaatagtcatg
gttttctacagatacttttttggcgggaaacatgccgatgccgtgcagttgggacttagt
ttcttgttgggaaaaccaattaggtccctagttcctgatgagaatgtcatcctagccatg
accattttcacaattcactgctggaagaggttctatgagtctcattttgttagcgtctat
agtgatcaatatatgaatgttagcttgtatctacttggcttttttcactattttggatca
gtaattagcatagttggagagtcacaaaattttctcaaaggtacagaaattgatttaaat
tggtcaagattgagcatgttagactgggcatgtgctctcatattccttgtatcaacatac
ctacagtatagatcaaatatcattctgtctaacttgaggaaagataagaaaggagttgtt
gttaccaaaaaacataaagtaccacatggaggattattcaattatgtcactgcaccccta
caattgacagaaatcatcttgtatttatgtttgtctgccatcttgagaagtgcttctaca
tttcactttgtcacactgtgggtattaatcaatcaaatggaatgtgcatatttatctcac
gaatggtcactcagaaaatttgaaaattatccaaaatctcgaaaaataataataccttat
gtattttag

DBGET integrated database retrieval system