KEGG   Nasonia vitripennis (jewel wasp): 100119456Help
Entry
100119456         CDS       T01081                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4-like
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100119456
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100119456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 441 aa AA seqDB search
MAENQGNSSNPSGQHNQGASSRTFNFPCLDFRTNAEVPNEAEKRRQLKLSFQAQSGNLPL
SNSTSSTITNSTMASACQQMSITRPTLPLPLPKLPARPRPVTQQEFLPDKAREKFKMCQS
MQSSGKLQLSPDTVYDFTSEDLQDLGEIGRGGFGTVNKMIHRISNTVMAVKRIRSTVDEK
EQKQLLMDLEVVMKSNECPCIVQFYGALFKEGDCWICMELMDTSLDKFYKFIYERLNERI
PECILGKITVATVKALNYLKEKLRIIHRDVKPSNILLDRRGNIKLCDFGISGQLVDSIAR
TRDAGCRPYMAPERIDPQRARGYDVRSDVWSLGITLMEVATGYFPYPKWNSVFEQLYQVV
QGDPPRLSPNENGNHFTMDFVNFVNTCLIKEETQRPKYNKLLEHPFIRNSEEATIDVAAY
IGGVLDNMANNGITPFTTNQP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaccagggcaactcgtccaacccctcgggtcagcataaccaaggtgccagc
agcaggacgtttaattttccttgcctggatttcagaaccaatgcagaagttccaaatgaa
gcggaaaaacgaagacagctgaaacttagctttcaagctcaaagtggcaacttaccactt
tcaaattcaaccagctccaccattactaattccacaatggcttctgcttgtcaacaaatg
tcgatcacgcgtccaaccttgcctttacctttaccaaaactccctgcaagacctcgtccg
gtgacgcaacaagaatttttacctgataaagcaagggagaaattcaagatgtgtcagtca
atgcaaagttcaggaaagttacagctctctccggatacagtgtatgacttcactagtgaa
gaccttcaggatttaggggaaattggcaggggaggttttggaactgtaaataaaatgata
cataggataagcaataccgtcatggctgtgaagagaattcgttcgacggtcgatgaaaaa
gagcagaagcaattattaatggacttggaagtggtcatgaaatccaatgagtgtccttgc
attgtgcaattttatggagctttatttaaggagggagactgttggatatgcatggaatta
atggatacatcattagacaagttttacaagtttatttacgaaagattaaatgaaaggata
cctgaatgtattctgggtaaaatcacagtagccacagtaaaggctttgaattacctaaaa
gaaaaactgcgaatcattcatcgcgatgttaaacccagtaatatactgctggatcgacgt
ggcaatataaaactctgtgattttgggatttcgggacaattggtggattcaatagctcga
actcgcgatgctggctgcagaccctacatggctcctgaaagaatagatcctcaacgagca
agaggctacgatgttagaagcgatgtatggtcccttggtataactttgatggaagttgca
acagggtactttccttatccgaaatggaattccgtttttgagcaactttaccaggtagtg
caaggtgatcctccgaggctgtctcccaatgagaatggaaatcattttacaatggatttt
gtcaacttcgtgaacacgtgcttaatcaaggaggaaactcaacgtccaaagtacaataaa
cttttagagcatccatttattaggaattccgaggaggcaacgatagacgtagccgcctac
ataggcggcgtcttggacaatatggctaataatggtatcacaccttttaccaccaatcag
ccttaa

DBGET integrated database retrieval system