KEGG   Nasonia vitripennis (jewel wasp): 100119466Help
Entry
100119466         CDS       T01081                                 

Definition
alkaline phosphatase 4-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100119466
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100119466
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100119466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 540 aa AA seqDB search
MKNTAALAIVGALLMCLCSLCSGFSVPSEHEETSFWMKSGQENLRRILSLQNNQNRAKNV
IIFIGDGMGLSTITSGRIFKGQQRGNSGEEYKLFFEKFPSTGFSKTYNVDRQVPDSAGTA
TAIFSGVKAQYRMLGLDAKAKYNTCDKNLNENSQLTTIATWAQESGMDTGFVTTTRVTHA
TPGALYAHTNNRDWECDSNIPAQHRGCVKDIARQLVEDAPGNKFKVIMGGGAGVLGMSSS
IADKEVCQRRDGRQLSEYWKEANPGGKLVTNVKELMSVDVANTSKLMGIFSDDHLPYAAV
KPDTVPTLANMTLQAIRMLRKNKKGFFLMVEGGKIDLAHHQNHAQLALREVAELDDAVTA
AVANVNIDETLVIVTADHSHAFTMNGYPERGNDILGLTESGSSQKYETLSYANGPGFFYH
RLNDTNNVNHTWKDLVNDENRKDPFYRHFAARYLKDETHGGEDVGVYAIGPYAHLFRSTF
EQNYIAHVVAYAACFKDWPSHCDQAYNRYFYEVSQRIHNSAATTTPALVLMFLGLMAYLL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatacggcagctctggcgatcgtcggcgcgctgcttatgtgcttatgtagcctc
tgttccggatttagcgtgcccagcgagcatgaagagacatcgttctggatgaaatccggc
caggagaatctccggcgaatcttgtcgctgcagaacaatcagaaccgtgcgaaaaacgtg
ataatattcatcggcgacggcatgggactgtcgaccataacatccgggcgtatcttcaaa
ggacagcagcgaggaaactccggagaggagtacaagctcttcttcgagaagttccccagc
accggattttcgaagacttacaacgtcgacaggcaggtaccggactcggctggtacagcc
acggcgatattctccggagtcaaagcccagtaccggatgctgggactcgacgccaaagcc
aagtacaacacctgcgacaagaacctcaacgagaacagccaactgacgaccatcgccact
tgggcccaggagtccggaatggataccggcttcgtgacgacgacgcgcgtgacgcacgcg
actcccggtgcactttacgcccacacgaacaaccgagactgggagtgcgacagcaacatt
ccggcccagcatcgcggctgcgtcaaagacatcgccaggcagctcgtcgaggatgcgcca
ggaaacaagttcaaggtgataatgggcggcggcgcaggagtcctgggcatgtccagctcg
atcgcggacaaggaggtctgccagcgtcgcgacggccgtcagctgagcgaatactggaaa
gaagccaatcccggcggtaagctcgtgaccaacgtcaaggagctcatgtccgtcgacgtg
gccaacacgagcaaactcatgggcatcttctccgacgatcacctgccctacgccgctgtc
aaaccggacacggtaccgacgctcgctaacatgaccctccaggccatcaggatgctcagg
aagaacaagaagggcttcttcctcatggtcgaaggtggcaagatcgacctggcccaccac
cagaaccacgcgcagctggccctgcgcgaggtggccgagctcgacgacgcggtgaccgcg
gcagtggccaacgtcaacatcgacgagactctggtgatcgtcacggccgatcactcccac
gcgttcaccatgaacggctaccccgagcgaggcaacgacatcctcggcttgaccgaatcc
ggcagcagccagaagtacgagaccctgagctacgccaacggacctggattcttctatcac
aggttgaacgacaccaacaacgtcaatcacacctggaaggacctggtgaacgacgagaac
aggaaggacccgttttacagacactttgccgctaggtacctcaaggacgagactcacggc
ggcgaggacgtcggcgtctacgcgataggaccctacgcccacctgttccgcagtaccttc
gagcagaactacatcgcccacgtggtagcctacgcggcctgcttcaaagactggccgtcg
cactgcgatcaggcgtacaaccgctacttttacgaggtgtcccagaggattcacaattcc
gctgctaccacgacgccggccctcgtccttatgttccttggcttgatggcctaccttctt
taa

DBGET integrated database retrieval system