KEGG   Nasonia vitripennis (jewel wasp): 100119475Help
Entry
100119475         CDS       T01081                                 

Definition
chitooligosaccharidolytic beta-N-acetylglucosaminidase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100119475
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100119475
   00603 Glycosphingolipid biosynthesis - globo series
    100119475
   00604 Glycosphingolipid biosynthesis - ganglio series
    100119475
   00511 Other glycan degradation
    100119475
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100119475
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100119475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 608 aa AA seqDB search
MKPLLCILALLLIGFGDARKQSFIRTFECLQSNRCQRTSRPVDPAAMRGHDNARTNIGLS
QHTSLQACRLVCSNAAGLWPIPTGPMTTGTNYLVVSPRSFQFLNVNDLSESARTFVSDAI
DVFLRNIQTSCGHDCKPAERKVVVHLKVESSSLQLDWETNEAYDLEISSSGSDVAVLIAA
QTVYGARHGLETLSQLTASTPSFNNYTGSSGNQLVILDSANIRDKPVFKHRGLLIDTGRN
FLPVSDIMRTIDALASVKMNVLHWHATDSQSFPIEIRSIPLMAMYGAYGPDKIYSVESMQ
SIVKYAKSRGIRVLLELDSPSHAGAGWEWGETQGLGNLAVCVNQQPWRDFCIQPPCGQLN
PVNPNTFAVLRSLYKDLLNIFGRTGVIHLGGDELFINCWNATEEVTAGMSKIGLGRTTED
FLKIWSNVHHKQLDMINEESGDKATDKAIVWSSLLTSPEFIENYLNKTKFVVQTWVEADK
DLNKKLLDLGYKLIVSTKDAWYLDHGFWGVTKYHTWRDAYKNQIPQHDGVLGGEACMWGE
YVSVGSLDSRVWPRTAAVAERLWSDPSKIGTAEAEPRLQAHIARLNQRRISPEAITPEWC
NQHEGQCL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcttctctgcatactcgctcttctgctgatcggctttggcgatgcgcgtaaa
cagtcattcatcaggacatttgaatgccttcagagcaatcgctgccagcggacatcacgt
cctgtcgacccagccgcaatgcgaggacatgacaatgctcgaacgaacatcggactgtcg
caacacacgagccttcaagcctgtcggctggtttgctcaaatgctgctggcctttggcct
atacctactggaccaatgactaccggtaccaattacctggtcgtcagtccccgtagcttc
caattcctaaacgtgaacgacctaagcgagtctgcgcgaaccttcgtctcagacgcgatc
gatgtcttcctcaggaacattcaaacaagttgtggccacgactgcaaacccgctgagcgc
aaggttgtcgttcatctgaaggtcgagtcttcgagcttacagctagactgggagaccaac
gaggcatacgatttggaaatctcaagcagtgggtcggacgtggcggttttgattgctgcc
cagacagtctacggagctcgtcatggtttggaaaccttgtctcagctaacagcctcgacg
ccttcgttcaacaactacacgggcagtagtggcaaccaacttgtgatcttggattctgca
aacataagggacaagcctgtattcaagcatcgcggtctgcttattgacacgggtcgtaat
tttctgccagtgtccgacatcatgcgcacaatcgatgcactcgcctctgtcaagatgaac
gttcttcactggcacgccaccgacagccagagctttccgattgagatacgcagtattccg
ctcatggctatgtacggcgcttacggacccgacaagatctacagtgtggagtctatgcag
tcaatcgtaaaatatgccaagtcacgagggattcgcgtgctcctggagctggactcgccg
tcacacgccggcgctggctgggaatggggcgaaactcagggtcttggtaatctggccgtt
tgcgtgaatcagcagccatggcgggatttttgcattcaaccgccttgcggtcaactcaat
ccagttaatcccaacacttttgcggtactcagaagcttatacaaggatttgctcaatatc
ttcggcaggactggtgttatccaccttggcggcgacgagctctttatcaactgctggaac
gccaccgaagaagtaacagccggtatgtcaaaaatcggactgggtcgtactacggaagac
ttcttgaaaatatggtcaaacgttcaccacaaacaattggatatgattaatgaggaaagc
ggagacaaggccacggacaaagctatcgtgtggagctcactgctgacctcgccggagttt
atagagaattacttaaacaagacgaagttcgtagttcaaacctgggtagaggctgacaag
gacctgaacaagaagctcctcgatctcggttacaaactgatcgtatcaactaaggatgct
tggtacctagatcatggcttctggggtgtgaccaagtaccatacttggcgtgatgcctac
aaaaatcaaattccgcagcatgatggagtgctaggaggcgaagcttgcatgtggggcgaa
tacgtatccgttggaagcttggactcccgcgtgtggccaagaactgctgcagtagctgag
aggctctggagcgatccctcaaagataggcacggccgaggctgagccgagactacaggcc
cacatcgccaggctgaaccaacggagaatctcgcctgaggccattactcccgagtggtgc
aatcaacacgaggggcagtgcctttaa

DBGET integrated database retrieval system