KEGG   Nasonia vitripennis (jewel wasp): 100119614Help
Entry
100119614         CDS       T01081                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nvi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:nvi00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:nvi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 304 aa AA seqDB search
MTASLALLIVLASLFQSHRIYAENTTTSPVPVVLWHGMGDSCCFSYSLGQIKTILEDNIP
GVYVKSIRIGNNVIEDVENSYFKNVNEQVQQVCDELAQDEKLTGGFNAIGFSQGGQFLRA
VAQRCGPPQMMNLISLGGQHQGVYGLPNCASLQHYLCNHLRQVLHYAAYSKYIQEKLVQA
EYWHDPLKEEEYKKNSVFLADINNELRINETYKENLQKLKNLVLVKFEKDTMVEPRISEW
FGFYKSGQDVEIETLHESALFIEDRLGLKQMDAEGKLHFLSVDGNHLQFTDSWFVGNVIE
KYLK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcgctggctctgctgatagttttggcgagtctttttcaaagtcatcggatc
tacgccgaaaacacgacgacgtcaccagttcccgtggtcctctggcatggcatgggcgac
agttgctgcttctcctacagtctcggccagataaagacaatcttggaggacaacattccc
ggggtctacgtcaagtccattagaattggaaataacgtgatagaggacgtggaaaacagc
tacttcaagaacgtgaacgagcaggtgcagcaggtctgcgacgagctggcccaggacgag
aagctgacgggcggattcaacgccattggattctcgcaggggggacagtttctgagagca
gtcgcccagagatgcggccctccgcagatgatgaacctgatatccctgggaggtcagcac
cagggcgtctacggtctgccgaactgcgcctcgcttcagcactacctgtgcaaccacctg
cggcaggtcctgcactacgcggcttactccaagtacatccaggagaagctggtccaagcc
gagtactggcacgacccgctcaaagaggaagagtacaagaaaaacagtgtcttcctagcc
gacattaacaacgagctgcgcatcaatgagacgtacaaggagaacctgcagaagctgaag
aatctggtgctagtcaagtttgagaaagatacgatggtcgagccgaggatctccgagtgg
ttcggcttctacaagtccgggcaggacgtcgagattgagacgctccacgagtcggccttg
tttatcgaggaccgactgggactgaagcaaatggacgccgagggtaaactgcacttctta
tcggtggatggcaaccacctgcagtttaccgactcttggttcgtcggaaacgtcatcgag
aagtacttgaagtga

DBGET integrated database retrieval system