KEGG   Nasonia vitripennis (jewel wasp): 100119652Help
Entry
100119652         CDS       T01081                                 

Definition
UDP-glucuronosyltransferase 2B31-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100119652
   00053 Ascorbate and aldarate metabolism
    100119652
   00500 Starch and sucrose metabolism
    100119652
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100119652
   00860 Porphyrin and chlorophyll metabolism
    100119652
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100119652
   00982 Drug metabolism - cytochrome P450
    100119652
   00983 Drug metabolism - other enzymes
    100119652
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100119652
Glycosyltransferases [BR:nvi01003]
 Others
  Hydrophobic molecule
   100119652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 526 aa AA seqDB search
MKFIQTICLLLSVINLGSVCRAYRILGVFPFNAKSHNIVFEALMKGLAKRGHQVDVVTHF
PLKNPVKNYNEIINLDGSLENLVNNFTIEFVSKITGDIVDLIATSYGNRVCQIMGFESMQ
KLIKNPPTNPPYDLVITEAFGANCYMGLGYVFKVPVVAVSSAVEYPWISHFIGNDDNPAY
VPNAYYVSTGKMNFWNRLKNAVINLIETRKFHVLTEDSQTESMRKYLSPDIPNIRQVEKN
VALTLVNSHPVLFGVKPITPALVQIGGLHIEGNDEILPTELKKWMDDSKHGVVYFTLGSM
VLIETLPEAQIKEIYASFRKISLVRVLMKIADASKLPPGLPDNVKVLPWIAQQPVLAHPN
TKVFITHGGLGGLQEALYFGVPMIGIPLFSDQFRNVAAFVAKQMMIKIDFNQFSGELLDS
SLQALLHNSVYKKKSMYYSRLFRSQPISPMNNAIYWIEYVIQNGDDSIRSPALQFFWWQL
ARLDVFGFIFLVIISSMSVIIIGIRYAVIKAFRMSQIRVPDKKKIR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcatacaaacaatttgtttgctattgagcgtcattaatcttggatcggtgtgc
cgtgcatacagaattctcggcgtttttccatttaacgcaaaaagtcacaacattgttttt
gaagcactgatgaaaggattggcaaaacgtggtcatcaagtcgacgttgtcacgcatttt
ccgctaaaaaatcctgtgaaaaactacaatgaaattataaatctcgacggatccttggaa
aatctcgtgaacaacttcaccattgaattcgtatctaaaatcacaggtgatatagtagat
ttaatagccacatcgtacggcaatagagtgtgccaaatcatgggctttgaatcaatgcaa
aagttgataaagaacccgcctacgaatccaccttacgatttagtgatcacggaggctttt
ggagctaattgttacatgggtcttggctacgttttcaaagtaccggtagtcgcagtatca
tcagctgtcgagtatccttggattagccactttatcggaaacgacgataaccctgcttac
gttccaaacgcttactatgttagtactggaaagatgaatttttggaatcgacttaaaaat
gcagttatcaatttgattgaaacgcgcaagttccacgttctcactgaagatagccaaacg
gaatcaatgagaaaatatttgagcccagatatacctaacattagacaagtagagaagaat
gtggctttaacacttgtaaacagtcatccagttttatttggtgttaaacctataacacca
gcattagtacaaatcggaggcttgcatatagaaggcaatgatgaaattttgcctactgag
ttaaaaaaatggatggatgatagcaagcatggagttgtctactttactctagggtcaatg
gtgttaatagaaacattacccgaagcgcaaataaaggaaatatatgcttcgtttagaaaa
atatcgctggttcgagttttaatgaaaatagctgacgcatctaagctaccgccaggatta
cctgataatgtcaaagtattgccctggattgctcaacaacctgttcttgctcatccaaat
acaaaggtatttattacacatggtggacttggaggattacaagaggctttatactttggc
gtgccaatgattggaataccattgtttagcgatcagtttagaaatgtcgcagcctttgtt
gctaaacagatgatgatcaaaattgacttcaatcaattttctggagaattgttggactca
tcacttcaagctctgcttcataattccgtttacaaaaaaaaaagtatgtattattcaaga
ctttttcgaagccaaccaatcagcccgatgaacaatgcaatttattggatcgaatacgtt
attcaaaatggtgatgactctataagatcaccagccttacaatttttttggtggcaatta
gcacgactcgacgtttttggattcatatttctagttattatttcaagtatgagtgtgatt
ataataggcattagatacgctgttataaaagctttcagaatgtctcaaattcgagttcca
gacaagaaaaagattcggtga

DBGET integrated database retrieval system