KEGG   Nasonia vitripennis (jewel wasp): 100119703Help
Entry
100119703         CDS       T01081                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 20
  KO
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100119703
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100119703
Ubiquitin system [BR:nvi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100119703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 924 aa AA seqDB search
MPLVATNCPHAESHGDLSIVEDIIAGKETFDKCVECDNEGPNLWLCLYPECRYVGCAEQH
LDHSTIHNRKFLTHSAHMNLSSNRIWCYSCQKEIHTRHIPSPSLSPNQLDLMVFGNKFSG
DASVSINCKPEKFDFHQYFQRFVDDSNAANRINTDRGDSFLDKSEDSPDSTDSDESRDFS
GKPRGLVGLQNIGNTCYMNSALQALSNVPPLTQFFLDCAHMVSYVARDRKPGLSLSYLNL
IREMWNKRTRGYTVPHAILTGIRTVHPMFRGYHQHDTQEFLRCFMDQLHEELKEHIEEDR
DGLQRLKSLGEPSSDEEETEVDGTGSSQSDAEYETCDSGVSEQSSLSDEGERGMKRRYSK
VSQADKLRNKFTSRSVKKGTADVTYTQQQRSSQSSPVKHHSKKQMKTRSIISDIFDGKLL
SSVQCLTCDRISTRIETFQDLSLPIPSRDHINMIHQGSLTPQKASPCSDVVYVTNQSGWI
SWFLQLMRSWLWGPTVSLHDCLSAFFSADELKGDNMYSCEKCNKLRNGIKFSKVLELPEV
LCVHLKRFRHELMFSSKIASYVSFPLEDLEMRPHLHKDCVSKETSYDLISVICHHGTAGG
GHYVCYALNPITNQWFEFDDQCVTPVSRETVQNCGAYVLFYRKRSQEIMQLREKTVELME
MSSKESSDLNFFVSRQWINRFNTFAEPGPIDNSDFLCPHGGVNPVRAKFVDKICTPIPQH
VWEFLYKTFGGGPVCTHLCECPICEEKHEAMEKRRLYELEIFNQLNRPDNPTALYALAMS
WFRQWQSFVKSKETQPPGPIDNSSISVNKGGQTVLKVGSDYGPIPEELWQFFVNTYGGGP
AVMLHSCQRPVPAHSSIPTHSAASPSQVHIDKNSKFPHVEAKLKQVTAAKSTESISMQDT
SAILADNNSTVNTDAQPAPRETSG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgttgcaacaaactgcccccatgccgagagtcatggcgatttgtcaattgtt
gaagacataatcgctggaaaggagacttttgacaaatgtgtcgagtgtgataatgaaggt
cctaatctttggctgtgcctgtatccagaatgccgctatgttggttgtgcggagcaacat
ctggatcacagcactatccataacaggaagttcctaacacactctgcccacatgaatctt
tcttcaaacaggatttggtgttactcctgtcagaaagagatccataccaggcacatacca
tcaccttcactctcaccaaaccagcttgatctcatggtttttggaaacaaattctctgga
gatgcctctgttagtataaattgcaagcctgagaagtttgattttcaccaatattttcaa
agatttgtagatgatagtaatgcagctaataggataaatacagacagaggagactctttt
cttgataaatcagaagattctcctgacagcacagattcagatgaaagcagagatttttca
ggaaaacctagaggattagttggtttgcagaatattggtaacacatgctacatgaattca
gcattgcaggcattatcaaatgttccaccattgacacaatttttcctggattgtgctcac
atggtgtcttatgttgctagagatcgcaaacctggtttgagcttaagttacttgaacctc
attagagaaatgtggaataaaagaaccagggggtacacggttccgcatgctatattgacg
ggtatacgaacagttcatccaatgtttagaggttaccatcagcacgacacgcaagagttc
ctacgctgtttcatggatcaacttcatgaagaacttaaagagcacattgaggaagatcga
gatggtttgcagcgattgaaaagtctcggcgagccttcatcagatgaagaggagactgaa
gttgatggaactggttcaagtcaatcagatgctgagtatgagacctgtgactctggagtg
agtgaacagagttcgctcagcgacgaaggcgaacgaggcatgaaacgaagatattccaaa
gtgagtcaggccgacaagctcagaaacaagttcacaagtcgtagtgtaaagaaaggcacc
gccgacgtcacttacactcaacaacaaaggtcttcccaaagctcaccagtaaaacaccat
tcaaaaaaacaaatgaaaacacgaagcattattagcgacatatttgatggtaaacttttg
agcagcgtgcagtgtctcacctgcgataggatatccacacgaatcgagacattccaggat
ttgtcgttgccgattccgagccgtgatcacattaacatgatacaccaaggatccctaact
ccgcaaaaagcaagtccttgttccgacgttgtttacgtgactaatcaatcaggctggatt
tcctggtttttgcaattaatgcgctcctggctatggggcccaactgttagtctccacgat
tgtctctctgcgttcttcagtgcggatgaattgaagggtgacaacatgtacagctgcgaa
aagtgcaacaagctgcgtaatggcatcaagttctcaaaagttctcgaattgcctgaagtt
ctctgcgtccatctcaaaagattccggcacgagctcatgttcagttccaagatcgcaagt
tacgtgtcctttccgttggaggatttagaaatgcgtcctcaccttcacaaagattgtgtc
tccaaggagacaagttatgacctcatctcagtgatttgccatcacggaactgccggcgga
ggtcactacgtctgctacgctctgaacccgattacaaatcagtggttcgaattcgatgat
cagtgtgtgacgccagtgtctcgcgaaactgtgcaaaactgcggcgcatacgtgctgttt
taccgaaagcgctcgcaggagattatgcagctgcgcgagaagaccgttgagctcatggag
atgtcatcaaaagagtcttcggatttgaatttcttcgtgtcaaggcagtggattaatcgg
ttcaatacttttgctgaacctggaccaattgacaactccgatttcctttgcccccatgga
ggtgtaaatcctgtgagagccaagtttgtagataaaatttgtacgcctatcccgcagcac
gtttgggagtttttgtacaaaacatttggtggtggaccagtttgtacgcatttatgtgaa
tgtcccatatgtgaagagaaacacgaagcaatggaaaaacgacgactttacgaattggaa
attttcaatcagctaaatcgccctgataatccaacggcactttatgctttagcgatgtct
tggttcaggcaatggcagagtttcgtaaaaagcaaagagactcagcctcctgggccgata
gacaatagttccatttctgtaaataagggcggtcaaacagttttgaaagttggttctgat
tatggtccaataccagaggagctttggcagttctttgtaaatacgtacggtggaggacca
gcggtgatgcttcattcgtgtcaacggccagtgcctgcacattctagtattcctacacat
tccgctgcaagtccgtcacaagttcacattgataagaactcaaaatttccccacgtagag
gctaaactgaagcaagtgaccgctgccaaaagcaccgaatcgatatcgatgcaggacact
agcgctatattagctgataataattcaacggtgaataccgatgctcaaccggctccaaga
gaaaccagcggctaa

DBGET integrated database retrieval system