KEGG   Nasonia vitripennis (jewel wasp): 100119703Help
Entry
100119703         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 20-like
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 864 aa AA seqDB search
MPLVATNCPHAESHGDLSIVEDIIAGKETFDKCVECDNEGPNLWLCLYPECRYVGCAEQH
LDHSTIHNRKFLTHSAHMNLSSNRIWCYSCQKEIHTRHIPSPSLSPNQLDLMVFGNKFSG
DASVSINCKPEKFDFHQYFQRFVDDSNAANRINTDRGDSFLDKSEDSPDSTDSDESRDFS
GKPRGLVGLQNIGNTCYMNSALQALSNVPPLTQFFLDCAHMVSYVARDRKPGLSLSYLNL
IREMWNKRTRGYTVPHAILTGIRTVHPMFRGYHQHDTQEFLRCFMDQLHEELKEHIEEXX
XXXXXXLRNKFTSRSVKKGTADVTYTQQQRSSQSSPVKHHSKKQMKTRSIISDIFDGKLL
SSVQCLTCDRISTRIETFQDLSLPIPSRDHINMIHQGSLTPQKASPCSDVVYVTNQSGWI
SWFLQLMRSWLWGPTVSLHDCLSAFFSADELKGDNMYSCEKCNKLRNGIKFSKVLELPEV
LCVHLKRFRHELMFSSKIASYVSFPLEDLEMRPHLHKDCVSKETSYDLISVICHHGTAGG
GHYVCYALNPITNQWFEFDDQCVTPVSRETVQNCGAYVLFYRKRSQEIMQLREKTVELME
MSSKESSDLNFFVSRQWINRFNTFAEPGPIDNSDFLCPHGGVNPVRAKFVDKICTPIPQH
VWEFLYKTFGGGPVCTHLCECPICEEKHEAMEKRRLYELEIFNQLNRPDNPTALYALAMS
WFRQWQSFVKSKETQPPGPIDNSSISVNKGGQTVLKVGSDYGPIPEELWQFFVNTYGGGP
AVMLHSCQRPVPAHSSIPTHSAASPSQVHIDKNSKFPHVEAKLKQVTAAKSTESISMQDT
SAILADNNSTVNTDAQPAPRETSG
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgttgcaacaaactgcccccatgccgagagtcatggcgatttgtcaattgtt
gaagacataatcgctggaaaggagacttttgacaaatgtgtcgagtgtgataatgaaggt
cctaatctttggctgtgcctgtatccagaatgccgctatgttggttgtgcggagcaacat
ctggatcacagcactatccataacaggaagttcctaacacactctgcccacatgaatctt
tcttcaaacaggatttggtgttactcctgtcagaaagagatccataccaggcacatacca
tcaccttcactctcaccaaaccagcttgatctcatggtttttggaaacaaattctctgga
gatgcctctgttagtataaattgcaagcctgagaagtttgattttcaccaatattttcaa
agatttgtagatgatagtaatgcagctaataggataaatacagacagaggagactctttt
cttgataaatcagaagattctcctgacagcacagattcagatgaaagcagagatttttca
ggaaaacctagaggattagttggtttgcagaatattggtaacacatgctacatgaattca
gcattgcaggcattatcaaatgttccaccattgacacaatttttcctggattgtgctcac
atggtgtcttatgttgctagagatcgcaaacctggtttgagcttaagttacttgaacctc
attagagaaatgtggaataaaagaaccagggggtacacggttccgcatgctatattgacg
ggtatacgaacagttcatccaatgtttagaggttaccatcagcacgacacgcaagagttc
ctacgctgtttcatggatcaacttcatgaagaacttaaagagcacattgaggaannnnnn
nnnnnnnnnnnnnnnnnnctcagaaacaagttcacaagtcgtagtgtaaagaaaggcacc
gccgacgtcacttacactcaacaacaaaggtcttcccaaagctcaccagtaaaacaccat
tcaaaaaaacaaatgaaaacacgaagcattattagcgacatatttgatggtaaacttttg
agcagcgtgcagtgtctcacctgcgataggatatccacacgaatcgagacattccaggat
ttgtcgttgccgattccgagccgtgatcacattaacatgatacaccaaggatccctaact
ccgcaaaaagcaagtccttgttccgacgttgtttacgtgactaatcaatcaggctggatt
tcctggtttttgcaattaatgcgctcctggctatggggcccaactgttagtctccacgat
tgtctctctgcgttcttcagtgcggatgaattgaagggtgacaacatgtacagctgcgaa
aagtgcaacaagctgcgtaatggcatcaagttctcaaaagttctcgaattgcctgaagtt
ctctgcgtccatctcaaaagattccggcacgagctcatgttcagttccaagatcgcaagt
tacgtgtcctttccgttggaggatttagaaatgcgtcctcaccttcacaaagattgtgtc
tccaaggagacaagttatgacctcatctcagtgatttgccatcacggaactgccggcgga
ggtcactacgtctgctacgctctgaacccgattacaaatcagtggttcgaattcgatgat
cagtgtgtgacgccagtgtctcgcgaaactgtgcaaaactgcggcgcatacgtgctgttt
taccgaaagcgctcgcaggagattatgcagctgcgcgagaagaccgttgagctcatggag
atgtcatcaaaagagtcttcggatttgaatttcttcgtgtcaaggcagtggattaatcgg
ttcaatacttttgctgaacctggaccaattgacaactccgatttcctttgcccccatgga
ggtgtaaatcctgtgagagccaagtttgtagataaaatttgtacgcctatcccgcagcac
gtttgggagtttttgtacaaaacatttggtggtggaccagtttgtacgcatttatgtgaa
tgtcccatatgtgaagagaaacacgaagcaatggaaaaacgacgactttacgaattggaa
attttcaatcagctaaatcgccctgataatccaacggcactttatgctttagcgatgtct
tggttcaggcaatggcagagtttcgtaaaaagcaaagagactcagcctcctgggccgata
gacaatagttccatttctgtaaataagggcggtcaaacagttttgaaagttggttctgat
tatggtccaataccagaggagctttggcagttctttgtaaatacgtacggtggaggacca
gcggtgatgcttcattcgtgtcaacggccagtgcctgcacattctagtattcctacacat
tccgctgcaagtccgtcacaagttcacattgataagaactcaaaatttccccacgtagag
gctaaactgaagcaagtgaccgctgccaaaagcaccgaatcgatatcgatgcaggacact
agcgctatattagctgataataattcaacggtgaataccgatgctcaaccggctccaaga
gaaaccagcggctaa

DBGET integrated database retrieval system