KEGG   Nasonia vitripennis (jewel wasp): 100119785Help
Entry
100119785         CDS       T01081                                 

Definition
(RefSeq) aurora kinase C-like
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100119785
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100119785
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100119785
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100119785
  Spindle formation proteins
   100119785
  Sister chromatid separation proteins
   Aurora kinases
    100119785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 390 aa AA seqDB search
MMKGRENNLQTSHNHLKSSNPKQSVLSEIQAQGNQEHPIKPVFNGSSALVKKEHNSRADN
LNDAKKSNELMPPPRMPVATKPTEAINVQKPEISQEKKETVKPQQTRSEDKNKKKQWVIT
DFDIGRPLGKGKFGNVYLAREKRSKFIVAMKVLFKDQIIKADIEHQVRREIEIQTHLRHP
NILRMYGYFYDDTRVYLILEYAPNGELFKELNKQPNKRFDEIRAATYISQLADALKYCHT
RKVIHRDIKPENLLLGVNGELKMADFGWSVHAPSSRRETLCGTLDYLPPEMVNGQTHDHT
VDLWGVGVLTYEFLVGQPPFLADTYNETYNKIKKASYKCPSYLSSGAKDLISKLLVVKPE
DRLTLDGILNHPWIVKNRTTEPTKDSSKRS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggcagggaaaataacttacagacaagtcataatcatctgaaaagcagcaat
cctaaacagtctgtgttatcagaaatccaagcacaaggcaatcaggaacatccgattaaa
cctgttttcaatggctcaagtgcacttgtcaaaaaagagcacaactctagagcggataat
ttaaacgatgccaaaaagtctaatgaacttatgccacctccaagaatgccagtagcaaca
aaacctacagaggcaattaatgttcagaagcctgaaattagtcaagaaaagaaagaaact
gtaaagccccaacaaacgaggtctgaagacaagaataaaaagaagcaatgggtcataaca
gactttgatattgggcgacctttgggaaagggaaagtttggcaatgtttacttagcgaga
gaaaagagatcaaaatttattgttgcaatgaaagtattatttaaagatcaaattattaaa
gctgatattgaacatcaagtacgcagagaaattgaaatacaaacacatttaagacatcca
aatatcttaagaatgtatggatacttctatgatgacacaagagtttacttaattttagaa
tatgcaccaaatggtgaattattcaaagaattgaacaaacagccaaacaagcgtttcgat
gaaataagagctgcaacatacatttcgcaattagctgatgccttaaagtactgtcataca
agaaaagtaatacatcgagatataaaacctgagaatttgctacttggagtgaatggtgaa
ttaaaaatggcagactttggctggtcagttcatgctccttcttctcgaagagaaacccta
tgtggcacacttgattatttacctccagaaatggtaaatggtcaaactcatgatcatacc
gttgatttgtggggagttggagttttgacctatgaatttcttgttggccaaccaccattt
ttagcagatacatataatgaaacatataataaaatcaaaaaagctagctacaaatgtcca
agctatttgagtagtggagcaaaggaccttatttctaagttactcgttgtgaaaccagaa
gataggctgactttggatggtattttaaatcatccttggattgttaaaaatcgtacgacg
gaaccaacaaaggacagctcaaaaagaagttaa

DBGET integrated database retrieval system