KEGG   Nasonia vitripennis (jewel wasp): 100119785Help
Entry
100119785         CDS       T01081                                 

Definition
serine/threonine-protein kinase 6-A-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100119785
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100119785
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100119785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 390 aa AA seqDB search
MMKGRENNLQTSHNHLKSSNPKQSVLSEIQAQGNQEHPIKPVFNGSSALVKKEHNSRADN
LNDAKKSNELMPPPRMPVATKPTEAINVQKPEISQEKKETVKPQQTRSEDKNKKKQWVIT
DFDIGRPLGKGKFGNVYLAREKRSKFIVAMKVLFKDQIIKADIEHQVRREIEIQTHLRHP
NILRMYGYFYDDTRVYLILEYAPNGELFKELNKQPNKRFDEIRAATYISQLADALKYCHT
RKVIHRDIKPENLLLGVNGELKMADFGWSVHAPSSRRETLCGTLDYLPPEMVNGQTHDHT
VDLWGVGVLTYEFLVGQPPFLADTYNETYNKIKKASYKCPSYLSSGAKDLISKLLVVKPE
DRLTLDGILNHPWIVKNRTTEPTKDSSKRS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggcagggaaaataacttacagacaagtcataatcatctgaaaagcagcaat
cctaaacagtctgtgttatcagaaatccaagcacaaggcaatcaggaacatccgattaaa
cctgttttcaatggctcaagtgcacttgtcaaaaaagagcacaactctagagcggataat
ttaaacgatgccaaaaagtctaatgaacttatgccacctccaagaatgccagtagcaaca
aaacctacagaggcaattaatgttcagaagcctgaaattagtcaagaaaagaaagaaact
gtaaagccccaacaaacgaggtctgaagacaagaataaaaagaagcaatgggtcataaca
gactttgatattgggcgacctttgggaaagggaaagtttggcaatgtttacttagcgaga
gaaaagagatcaaaatttattgttgcaatgaaagtattatttaaagatcaaattattaaa
gctgatattgaacatcaagtacgcagagaaattgaaatacaaacacatttaagacatcca
aatatcttaagaatgtatggatacttctatgatgacacaagagtttacttaattttagaa
tatgcaccaaatggtgaattattcaaagaattgaacaaacagccaaacaagcgtttcgat
gaaataagagctgcaacatacatttcgcaattagctgatgccttaaagtactgtcataca
agaaaagtaatacatcgagatataaaacctgagaatttgctacttggagtgaatggtgaa
ttaaaaatggcagactttggctggtcagttcatgctccttcttctcgaagagaaacccta
tgtggcacacttgattatttacctccagaaatggtaaatggtcaaactcatgatcatacc
gttgatttgtggggagttggagttttgacctatgaatttcttgttggccaaccaccattt
ttagcagatacatataatgaaacatataataaaatcaaaaaagctagctacaaatgtcca
agctatttgagtagtggagcaaaggaccttatttctaagttactcgttgtgaaaccagaa
gataggctgactttggatggtattttaaatcatccttggattgttaaaaatcgtacgacg
gaaccaacaaaggacagctcaaaaagaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system