KEGG   Nasonia vitripennis (jewel wasp): 100119821Help
Entry
100119821         CDS       T01081                                 

Definition
histone deacetylase 6-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1094 aa AA seqDB search
MGLCASIKSELDARANLISAARKLADSEIQLIKAIDNSRHGNSDKELKTMSVKAKNSSNF
INKKSARIANAKPSAAILAAKREAAQRKKALEKKSSNTVIRDIYQKAIDAKEMIRKDTGL
VYDESMAEHRCLWDENYPECPERFTRVFQRCKELGLVERCKYITPRSAEYSELLLKHTPA
HIEILKSTEGCNNEKKLEDLSSKYDAIYFHPSTYQLSLLATGSTINLVENICKENIQNGM
AIIRPPGHHAMKAEYCGYCFFNNVAISAEVALKNNLAKRILIVDWDVHHGQATQQMFYND
PRVVYFSIHRYENGEFWPNLRESNYHYIGDGPGEVGLMNITPACYTHLLSSLLGLAAGKV
AVVLEGGYCLKSLAESAALTLRTLLGDPCPMIEDLVPPCKSIQETILNVIYAHRLHWKCY
QHQDSYSVNSTSSSDKKQDQHLPIVLFNGPDELPTIFETRNCYPVQSQDELHEINKKLEH
LQQITNLKKAPNRVCIVYDDRMLKHYNVVDESHPEKPGRITSIFSKHKDYNLLERCILLQ
GRAASEEEILLAHTQDYLDNIKKTAETKLKDLAKQASSLNSVYLHPETWTSAAISAGSLL
QVVDSILNGESQSGVAIVRPPGHHAEEDAACGFCIFNNVAIAAKYAVSCHNLKRVLIVDW
DIHHGNGTQSILENDSSILYISLHRYDNGSFFPHSKAANYNVVGTGKGEGFNVNIPWNKR
GMGDAEYIAAFQQVVMPIAYQYNPELVLVSAGFDACIADPLGGCKVSPEMYGHMTHWLSS
LANGRIILTLEGGYNVNSISHAMTMCTKALLGDPLVPLDAHQVACPSAVASINNVLQTHK
QYWPNLVFQKALPQENVLPKARVPRAKPTERLSTRENFPSLPHNGDPEQEPERNQSQPED
STEQILQLEIHLDNLSIRECVNPDKKKEDFSNPGGSSTGGSSGTDQPGTSSQGSTSETLA
DYLQDNLQALLAEEMFAVIPLSDCPHLGSVKEVPASGIDVNSPCVECSSTVENWICLECY
TVHCARNINQHALLHEQSTQHPLTLSFNDVSVWCYGCEAYIDNPRLYAARNAVHIGKFHT
ELPWTYSDNAGSSS
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggggctttgcgcttctattaagtcggaattagatgcacgtgccaatctcatcagcgct
gctaggaaattagcagacagtgaaattcagttgataaaagcaattgataattctaggcat
ggtaattcagataaagaattgaaaaccatgtcagtaaaggctaaaaactctagcaacttt
atcaacaaaaaatcagcaaggatagctaatgcaaaaccctctgcagctattcttgctgca
aaaagagaagctgcacagcgaaagaaggccttggaaaagaagagtagtaatacagttatt
cgagacatttaccagaaagccattgatgcaaaagagatgattcgaaaagacactggactt
gtatatgatgagtctatggcagagcatagatgtttatgggatgagaattacccagaatgt
ccagaaagatttactagagttttccaaaggtgcaaagagttaggattagttgaacgctgt
aaatatattactccacgatctgctgagtatagtgaactacttttaaaacatacacctgcc
cacatagagatactgaaatcaactgaaggttgtaacaatgaaaagaaattggaagacctg
tcttcaaaatatgatgctatttacttccatccatctacatatcaactgtcactacttgca
acaggatcaacaataaatttagttgaaaatatttgtaaagaaaatattcaaaatggaatg
gctataataagacccccaggtcatcatgccatgaaagcagaatactgtggatactgtttt
ttcaacaatgtagctatatctgccgaagtagccttaaaaaataatttagcaaaaagaatt
cttatagtagattgggatgttcaccatggacaagcaactcaacaaatgttttataatgat
ccaagagtggtttatttttctatacatcgttatgaaaatggagaattttggcctaatttg
agagaatcaaattatcattatattggagatgggcctggggaagttggtttaatgaatatt
acccctgcctgttacactcatttactgtcttcactccttggtcttgcagctggtaaagta
gctgtagttttagagggtggatactgtttaaaatcattggcggaaagtgccgcactcact
cttagaacgcttttaggagatccatgtcctatgatagaagatttagtaccaccttgtaaa
agcattcaagaaactatattaaatgtgatatatgcacatagattacattggaaatgttat
cagcatcaagattcttacagtgttaacagcactagcagttctgataaaaaacaagatcag
catttaccaatagttttattcaatggtccagatgagttgccaactatttttgaaactcga
aattgctatcctgtacaaagccaggacgaattgcatgaaataaacaaaaaattggagcat
cttcaacaaattacgaatcttaaaaaagctccgaatcgagtatgcatcgtttacgatgat
agaatgttaaaacattacaatgtggtggatgaatctcatcccgaaaaaccaggcagaatc
accagcattttttcaaaacacaaagattataatttgcttgaacgttgtattttactgcag
ggaagagcagcaagtgaggaagaaattttattggcgcatacacaagactatcttgataat
attaaaaagacagcagaaacgaaattaaaagacttagccaaacaggcatcaagtttaaat
tctgtatatttacatcctgaaacttggacaagtgctgcaatatcagctggttcgttacta
caagtagtagatagtattttgaatggagaaagtcaaagtggagtggctattgtcaggcct
cctggtcatcatgctgaggaggacgcagcatgtggtttttgcatttttaataatgtggct
attgcagctaaatacgccgtctcatgccacaatttgaagagagtgttaattgttgattgg
gatatccatcatggaaatggaacacagtctattttagaaaacgattcgtcgattttatat
atttctttacatcgttatgacaatggcagtttcttccctcattccaaagcagctaactac
aatgtagtaggtactggtaagggagaaggattcaatgtaaatattccttggaataagagg
ggaatgggtgatgctgaatacatcgcagcctttcaacaggtggtaatgccgatcgcttat
caatacaatcctgagttagttctagtctcagcaggctttgatgcttgcattgctgatcct
ttaggcggctgcaaagtcagtcccgagatgtacggacacatgacgcattggctttcgtct
ctagcaaatgggcgaataatccttaccttggaaggtggctataacgtgaattcaatcagc
cacgcaatgacaatgtgcactaaagcattactaggtgatcctttggtgcccttggatgcg
catcaggttgcctgcccgagcgcggtagcttccatcaacaacgtcctccaaacgcacaaa
cagtattggccaaatttggtttttcaaaaggcattacctcaagagaatgtgcttccaaaa
gctcgagtgccacgagctaagccaactgaacgtttgagcacgcgcgagaattttccgagt
cttccacacaacggcgatcctgagcaagaacccgagcgtaatcaatcgcagccagaagat
tctaccgagcaaattttgcaacttgagattcatctggataatttatcgattagagaatgc
gttaatcctgataagaagaaagaggattttagtaatccaggaggaagctcaacgggtggt
agttccggcacagatcagccgggaacttcttcgcaaggatcgactagtgaaactctggca
gattatctacaagacaatcttcaggcactgttagccgaagaaatgttcgccgtgattcca
cttagtgattgtccacatttgggctcagtcaaagaagttccagcttccggtattgacgta
aatagcccttgtgtggagtgttcaagtactgttgaaaattggatttgtctcgaatgttac
acagtacactgcgctcgtaatatcaatcaacacgcattgctacatgaacagtccactcaa
catccactaactctaagttttaatgatgtatcggtttggtgttatggttgcgaggcttat
atagataatccacgtttatatgcagcgcgaaatgccgtccatatcggtaaatttcacaca
gaattaccatggacttattcagacaatgctggaagctcaagttaa

DBGET integrated database retrieval system