KEGG   Nasonia vitripennis (jewel wasp): 100119821Help
Entry
100119821         CDS       T01081                                 

Definition
histone deacetylase 6
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100119821
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100119821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1128 aa AA seqDB search
MIVIIKINTHQYCASKHHVHLKKREGTHICIAVLILNMSELDARANLISAARKLADSEIQ
LIKAIDNSRHGNSDKELKTMSVKAKNSSNFINKKSARIANAKPSAAILAAKREAAQRKKA
LEKKSSNTVIRDIYQKAIDAKEMIRKDTGLVYDESMAEHRCLWDENYPECPERFTRVFQR
CKELGLVERCKYITPRSAEYSELLLKHTPAHIEILKSTEGCNNEKKLEDLSSKYDAIYFH
PSTYQLSLLATGSTINLVENICKENIQNGMAIIRPPGHHAMKAEYCGYCFFNNVAISAEV
ALKNNLAKRILIVDWDVHHGQATQQMFYNDPRVVYFSIHRYENGEFWPNLRESNYHYIGD
GPGEGGDEKGLMNITPACYTHLLSSLLGLAAGKVAVVLEGGYCLKSLAESAALTLRTLLG
DPCPMIEDLVPPCKSIQETILNVIYAHRLHWKCYQHQDSYSVNSTSSSDKKQDQHLPIVL
FNGPDELPTIFETRNCYPVQSQDELHEINKKLEHLQQITNLKKAPNRVCIVYDDRMLKHY
NVVDESHPEKPGRITSIFSKHKDYNLLERCILLQGRAASEEEILLAHTQDYLDNIKKTAE
TKLKDLAKQASSLNSVYLHPETWTSAAISAGSLLQVVDSILNGESQSGVAIVRPPGHHAE
EDAACGFCIFNNVAIAAKYAVSCHNLKRVLIVDWDIHHGNGTQSILENDSSILYISLHRY
DNGSFFPHSKAANYNVVGTGKGEGFNVNIPWNKRGMGDAEYIAAFQQVVMPIAYQYNPEL
VLVSAGFDACIADPLGGCKVSPEMYGHMTHWLSSLANGRIILTLEGGYNVNSISHAMTMC
TKALLGDPLVPLDAHQVACPSAVASINNVLQTHKQYWPNLVFQKALPQENVLPKARVPRA
KPTERLSTRENFPSLPHNGDPEQEPERNQSQPEDSTEQILQLEIHLDNLSIRECVNPDKK
KEDFSNPGGSSTGGSSGTDQPGTSSQGSTSETLADYLQDNLQALLAEEMFAVIPLSDCPH
LGSVKEVPASGIDVNSPCVECSSTVENWICLECYTVHCARNINQHALLHEQSTQHPLTLS
FNDVSVWCYGCEAYIDNPRLYAARNAVHIGKFHTELPWTYSDNAGSSS
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaatcataaaaattaacactcaccaatattgtgccagtaaacatcatgtgcac
ttgaaaaaaagggaggggacacacatttgcatagcagtcttgattctaaatatgtcggaa
ttagatgcacgtgccaatctcatcagcgctgctaggaaattagcagacagtgaaattcag
ttgataaaagcaattgataattctaggcatggtaattcagataaagaattgaaaaccatg
tcagtaaaggctaaaaactctagcaactttatcaacaaaaaatcagcaaggatagctaat
gcaaaaccctctgcagctattcttgctgcaaaaagagaagctgcacagcgaaagaaggcc
ttggaaaagaagagtagtaatacagttattcgagacatttaccagaaagccattgatgca
aaagagatgattcgaaaagacactggacttgtatatgatgagtctatggcagagcataga
tgtttatgggatgagaattacccagaatgtccagaaagatttactagagttttccaaagg
tgcaaagagttaggattagttgaacgctgtaaatatattactccacgatctgctgagtat
agtgaactacttttaaaacatacacctgcccacatagagatactgaaatcaactgaaggt
tgtaacaatgaaaagaaattggaagacctgtcttcaaaatatgatgctatttacttccat
ccatctacatatcaactgtcactacttgcaacaggatcaacaataaatttagttgaaaat
atttgtaaagaaaatattcaaaatggaatggctataataagacccccaggtcatcatgcc
atgaaagcagaatactgtggatactgttttttcaacaatgtagctatatctgccgaagta
gccttaaaaaataatttagcaaaaagaattcttatagtagattgggatgttcaccatgga
caagcaactcaacaaatgttttataatgatccaagagtggtttatttttctatacatcgt
tatgaaaatggagaattttggcctaatttgagagaatcaaattatcattatattggagat
gggcctggggaaggtggcgatgaaaagggtttaatgaatattacccctgcctgttacact
catttactgtcttcactccttggtcttgcagctggtaaagtagctgtagttttagagggt
ggatactgtttaaaatcattggcggaaagtgccgcactcactcttagaacgcttttagga
gatccatgtcctatgatagaagatttagtaccaccttgtaaaagcattcaagaaactata
ttaaatgtgatatatgcacatagattacattggaaatgttatcagcatcaagattcttac
agtgttaacagcactagcagttctgataaaaaacaagatcagcatttaccaatagtttta
ttcaatggtccagatgagttgccaactatttttgaaactcgaaattgctatcctgtacaa
agccaggacgaattgcatgaaataaacaaaaaattggagcatcttcaacaaattacgaat
cttaaaaaagctccgaatcgagtatgcatcgtttacgatgatagaatgttaaaacattac
aatgtggtggatgaatctcatcccgaaaaaccaggcagaatcaccagcattttttcaaaa
cacaaagattataatttgcttgaacgttgtattttactgcagggaagagcagcaagtgag
gaagaaattttattggcgcatacacaagactatcttgataatattaaaaagacagcagaa
acgaaattaaaagacttagccaaacaggcatcaagtttaaattctgtatatttacatcct
gaaacttggacaagtgctgcaatatcagctggttcgttactacaagtagtagatagtatt
ttgaatggagaaagtcaaagtggagtggctattgtcaggcctcctggtcatcatgctgag
gaggacgcagcatgtggtttttgcatttttaataatgtggctattgcagctaaatacgcc
gtctcatgccacaatttgaagagagtgttaattgttgattgggatatccatcatggaaat
ggaacacagtctattttagaaaacgattcgtcgattttatatatttctttacatcgttat
gacaatggcagtttcttccctcattccaaagcagctaactacaatgtagtaggtactggt
aagggagaaggattcaatgtaaatattccttggaataagaggggaatgggtgatgctgaa
tacatcgcagcctttcaacaggtggtaatgccgatcgcttatcaatacaatcctgagtta
gttctagtctcagcaggctttgatgcttgcattgctgatcctttaggcggctgcaaagtc
agtcccgagatgtacggacacatgacgcattggctttcgtctctagcaaatgggcgaata
atccttaccttggaaggtggctataacgtgaattcaatcagccacgcaatgacaatgtgc
actaaagcattactaggtgatcctttggtgcccttggatgcgcatcaggttgcctgcccg
agcgcggtagcttccatcaacaacgtcctccaaacgcacaaacagtattggccaaatttg
gtttttcaaaaggcattacctcaagagaatgtgcttccaaaagctcgagtgccacgagct
aagccaactgaacgtttgagcacgcgcgagaattttccgagtcttccacacaacggcgat
cctgagcaagaacccgagcgtaatcaatcgcagccagaagattctaccgagcaaattttg
caacttgagattcatctggataatttatcgattagagaatgcgttaatcctgataagaag
aaagaggattttagtaatccaggaggaagctcaacgggtggtagttccggcacagatcag
ccgggaacttcttcgcaaggatcgactagtgaaactctggcagattatctacaagacaat
cttcaggcactgttagccgaagaaatgttcgccgtgattccacttagtgattgtccacat
ttgggctcagtcaaagaagttccagcttccggtattgacgtaaatagcccttgtgtggag
tgttcaagtactgttgaaaattggatttgtctcgaatgttacacagtacactgcgctcgt
aatatcaatcaacacgcattgctacatgaacagtccactcaacatccactaactctaagt
tttaatgatgtatcggtttggtgttatggttgcgaggcttatatagataatccacgttta
tatgcagcgcgaaatgccgtccatatcggtaaatttcacacagaattaccatggacttat
tcagacaatgctggaagctcaagttaa

DBGET integrated database retrieval system