KEGG   Nasonia vitripennis (jewel wasp): 100119822Help
Entry
100119822         CDS       T01081                                 

Definition
(RefSeq) protein kinase DC2
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100119822
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100119822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 331 aa AA seqDB search
MSSETTSDEESSQEDLQRYEIDDLEMIRTIGTGTFGRVILCRHRGKPLALKILSMVDVIR
LKQVDHVRNEITVLKEVKHPFIVNMLWSGRDEARVYMLLEFVAGGELFSYLRAAGRFSGR
TSCFYAAEIVCALEYLHSKHIVYRDLKPENLLLDSQGHLKITDFGFSKKLTDRTWTLCGT
PEYLAPEIIQSKGHNKAVDWWALGILIYEMLAGFPPFFDDNPFGIYEKILGGRIEWPKHM
DPIAKDLVKKLLVADRTKRLGNMRQGADDVKRHRWFKLVDWSQVPLRALVPPISPRLKAP
GDPSCFDDYPETDWRSQPPLPPDQLALFQDF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgagaccacgtccgacgaggagtcttcccaggaggatctgcagaggtacgag
atcgacgacctcgagatgatcaggaccatcggtacgggaacgttcggccgagtaatcctg
tgccggcaccggggaaaaccgctggctctgaaaattttgtcgatggttgacgtcatccgg
ctcaagcaggtggatcacgtgcgcaacgaaattaccgtcctcaaagaagtcaagcatccc
ttcatcgtcaacatgctgtggagcggcagagacgaagcgagggtctacatgctgctggaa
ttcgtcgcgggtggcgaacttttttcctacctacgtgccgccggacgtttctccggcagg
accagttgcttctacgccgccgagattgtctgcgctctcgagtacctgcacagcaagcac
attgtctaccgggacttgaaacccgaaaatctgctgctagacagtcagggtcatctcaag
atcaccgattttggattttctaaaaagctgaccgacagaacctggacactctgcggcaca
ccggagtacttggctccggagatcattcagagcaaaggacacaacaaagccgtcgactgg
tgggcactgggtatcttgatctacgagatgctggcaggatttccgccattcttcgatgac
aatccctttggaatttacgaaaaaattctcggcggtaggatagagtggcccaaacacatg
gatccgatcgccaaggacctggtcaagaagctgctggtagcggacaggacaaagaggctt
ggtaacatgcgtcaaggtgccgatgatgtcaagaggcatcgatggttcaaactcgtcgac
tggtcacaggtaccgctaagagctttggtaccgccgataagcccaaggctgaaagctccg
ggagatccgagctgtttcgacgactatccggaaaccgactggcgatcccagccacctcta
ccacctgaccagttggccttgtttcaagatttttga

DBGET integrated database retrieval system