KEGG   Nasonia vitripennis (jewel wasp): 100119902Help
Entry
100119902         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 8-like
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100119902
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100119902
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100119902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 1000 aa AA seqDB search
MQNMDPAIVAELNEKYRNLNKEVLKLNFKGRKPEHIYERLPKIYASGSEAKEANKHDQAY
IFFKRWIACVDWLKGQHLNKEVITKFFSNDKVEDVKKLLQEVSNSIQLECEIKPKGPQIK
DSHTNSVNENFNDLELRLPETPNDEPQPKENDEITCADLFNILNQGIRSSEKRLLIIDVR
KEEDYLESKIPFPENIVHIPAEKIQPNKSPDFYRYLLIDDNLALDRYAKRSAKDIDIIVL
MDSNSSLNSMNVKSPISMFKKSLKECDKNTKYKRIAILKGGFEEWIKTYPAFVTDPVKKE
LSPTPSTPDSSVSSFNASYSFLNISQSREETTSPILSGRHPTGPRVKDPSNANSQVSSRS
DKSSSSLYNHLLVPYQKVLASSTIANGKYTHPTTQPSQNNNPTAPPPPNCISDKQLLISN
NMKEAKVVIEKLKPQVDRSKKPTLGGKPTMPTTNQLEKELSDTQYSILQYEKKLQKGMQN
NWAREQLETLRKKEQEIMVKLGRTRNTRSADGNPGKLYPELSLSSMTLEPRTRATRLSKL
NLSEEKENIPKPPIKDKIEPMIVDPQPPLTPAHMEVDEEETIRREPLKSENVSINPGLKR
SHSSPNLVLQNGPKSIPAVNRSLKPNLVPKNVSRTRIPSAISSKGRELRLEPIFSSIKLH
PGITGLKNLGNSCYMNSIIQCLSNTVYLAKYFNDNKYTDHLNRNIDKVARGYVAEEVAQV
IKALWRGQYKSISPRDLKNVIGQYKMQFENFDQQDSHEFLMFLLDWMHNDLKQKIKTRYD
RALTIAETEWEKSMNGQSSVISKLFFGQLRSTIECLYCNQNSTTYETFNSLTMSLPTTNK
CTLDECVKKFVSGQRVSGWKCPNCKVPREGMKKFDIAKLPHIIVIHLNRFGETSGWLEKK
NTAVDFPLTNFIMRHYVVQDNDNFNNSQSYNYNLYAMSNHYGTMEGGHYTAYCKSNHQNK
WYKYDDHTVSEVQANVVKNQSTSAYLLFYALASAENYLNS
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacatggacccagcaatagtagcagagttgaatgaaaaatacagaaatttaaac
aaagaggtcttgaaactaaattttaaaggccgtaaaccagaacatatttatgagcgtcta
cctaaaatctatgcatctggcagtgaagctaaagaggctaacaaacatgaccaggcttac
atttttttcaaaagatggatagcttgtgtggattggttaaagggacaacatttgaacaag
gaagtgataacaaagtttttttcaaatgataaagttgaagatgtcaaaaaactactacaa
gaagtttcaaatagtatacaacttgaatgtgagataaaaccaaaggggcctcaaattaaa
gacagtcatacaaacagtgtaaatgaaaatttcaatgatttagaacttcgattaccagaa
actccaaatgatgaacctcaacccaaggaaaatgatgaaatcacatgtgcagatttattt
aacattcttaatcaaggtatccgaagcagtgaaaaaagactgttgataatagatgtaagg
aaagaagaagactatttagaatcgaaaattccattcccagaaaacattgttcacattcct
gcggaaaaaattcaaccaaacaaatctccagatttttatcgatacttgctgatagatgat
aatttagcacttgatcgttatgcaaaacggtcagctaaggatatcgatattattgtgctg
atggattcaaattcttctcttaattcaatgaatgtaaagagtcccataagtatgttcaaa
aaaagcttaaaagaatgcgataaaaatacaaaatacaaaaggatagccatcttaaaaggt
ggttttgaagaatggatcaagacatatccagcttttgttacagaccctgttaaaaaagag
ctatctccaacaccttcaacaccggattcttcagttagttcattcaatgcaagttacagc
tttctcaatatttctcaatcacgtgaagaaacaacctctcctattttatcaggaagacat
ccaactggtccacgagttaaagatccatcaaacgcaaattcacaagtatcctcaagaagt
gataaaagctcatcttctctctacaaccatcttctggtgccttatcaaaaagtattggca
tcttcaacaatagcaaatggtaaatatacgcatccgacgacacagccatctcagaacaat
aacccgacagcaccaccacctccaaattgtataagtgacaaacagctgctgatttcgaac
aatatgaaagaagcaaaagttgtaatagagaagttaaaaccacaagtagatcgcagtaaa
aagccgactcttggtggaaaaccgactatgcctacaacaaaccaattagaaaaggagcta
agcgatacacagtattccatattacagtatgagaagaaactacaaaaaggtatgcagaac
aattgggcaagagagcagttagagactttgcgaaagaaagagcaggaaattatggtgaaa
ttggggcgaacaagaaacacccgatcggctgatggaaatcctggcaaactttatccagag
ttaagtctgtcaagcatgacactagaaccaagaacgcgagctacacgtttatcgaaactc
aatcttagtgaggaaaaagaaaatattccaaaaccaccaattaaggataaaatcgaacct
atgatagttgatccgcagccgcctttgactccggcacatatggaggtagacgaagaggag
actattcgcagggaacctctaaaatctgaaaatgtatctattaatccgggactgaaacgc
tcacattctagtcccaacctcgtcctgcagaatgggccgaaatcaataccggctgtcaat
agatcgttaaaaccaaatctagtacctaaaaacgtcagcagaactcgtataccttcagct
atatcatcgaagggtagagaactgcgtttggaaccaatattttccagtataaagttgcat
ccaggaatcacaggcttaaaaaatctgggcaactcgtgctacatgaatagcataatccag
tgcctgagcaacactgtctatctggccaagtactttaacgataacaagtacacggatcac
ctgaaccgcaacatcgacaaggtagccagaggctacgtggccgaggaagtagcccaggtg
atcaaggccctatggaggggacagtataagagcatatcgccaagagacctcaagaacgta
atcggccaatacaaaatgcagttcgagaacttcgatcaacaagactctcatgaatttctt
atgtttcttctcgactggatgcacaatgatctgaagcagaaaattaaaactaggtacgac
agggcactgacgatcgctgaaaccgagtgggaaaagtccatgaatggccaaagctccgtc
atctcaaagctgttcttcggacagttgaggtcgacgatcgaatgcctctactgcaatcag
aacagcactacctacgagaccttcaacagccttaccatgtccttgcccaccaccaacaag
tgcaccttggatgaatgcgtgaaaaagtttgtgagtggtcagcgagtttctggatggaag
tgtccgaattgcaaagtaccacgcgaaggtatgaagaagttcgacatcgcaaagttgccg
cacataatcgtcatccacctcaaccgcttcggtgaaacgagcggctggctcgagaagaag
aataccgccgttgactttccactaacaaactttatcatgagacattacgttgtccaggat
aacgataatttcaacaactcccagagctacaactacaacctgtacgccatgtcgaaccac
tacgggaccatggaaggaggacactacacggcttattgcaagagcaatcatcagaacaaa
tggtataaatacgacgaccacacagtaagcgaagtacaggcaaacgtagtgaagaatcag
agcacgagcgcgtatctgttattctacgctttggcttcagccgagaactatctgaacagt
taa

DBGET integrated database retrieval system