KEGG   Nasonia vitripennis (jewel wasp): 100119908Help
Entry
100119908         CDS       T01081                                 

Definition
uncharacterized LOC100119908
Orthology
K16172  
insulin receptor substrate 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:nvi04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:nvi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 1261 aa AA seqDB search
MSSPSVVQSPGPVVLAAHLKKLKTLKKKYFVLHAEVLGHPACLEYYDSKKKYESRQPPKR
SISVRSCFNINNRTDTKHKHVIALYTKDDCFSLVLENEKDQEQWLNALLLLQNGDQTDGE
QPRPTFEHIWQVIMQKKGLGERKNITGPYRLCLTDRVLSLVKLGADDKSDSIEFSXXXXX
XXXWMEVEDNNIAQNMHTAINNAMTNSSSTKDEGPRQRLRSSSANEASKPISVLQRRHTA
QKLHSFSPLEEQRMHEDQVAPLQEQNVTASAPSQGSQTQTTSTSNTHMAAVGVTESGILG
TSASTKSSAAMTNRRRHSVASHPIPSTTNNNISQSTHANTTSSSSTTSTTATATISHQRT
LSLPLAAVAINQTQSSKRSVLRCVPTVRDRCDSLPSRARTTSEGHPGGPVITTSVISNSV
ITTMAQQSLQHGRVAYLAPHVPRPHSMHSRVLSYSPPVASMPISPASAACSTDSAGSSLS
MDDASENIMEEAVISKYGHSLTPDEPVILEENGDDYVPWSASHQQKYSPNFKSCSPSQQS
SYVEMYSPCSSSPGRGAYMPMSPATGAHSHSRTSSLVEESSTLPDGYVPMAPVGDHGYVD
MDPANNHNGHFPDDMSQHGGSSCSVTSGTPSTDLRFSEYHLDKVTSFLPPGEDLQARPTR
AYSVGSRPEPANRHRKNRLEIAQQEASRVRAFSVGSRSKRPEIGRLANVVTAPLVAGIES
SHSNKSYSAPLLSSSWGHQSGCSITSERMEDLMELDFTRPNGPVALSSPPSSYSQSQSYS
TATDTSSYVDMSPGQPPISTTAPYVDMNGPTKINRNNNNSNSNNNNNNNNITTANHNHNH
SLVMVSTHKPVITQVSSLLKPVEETESPYMRMDKGLEDWTQSRISPKQVPSPCQDDYMQM
NGPPGGTRTAPMDLPQPRRPPEGYVEMSFKAKPSLEQDYINMSMGLGRNNRRHHNNNRKK
KCSLPIAIQAGSKSSKTPNFLPLNGSPSSESLASTPASPPRATPTGSSATIFPFSLNSPQ
SPVKPFNTSQAGTDNKSSSVGDVSSTKNESGNIVPVTRKISAPSPLPGVDGCPSSKKAHD
NPPDTSVNSTTRNVTVTSKQNDPVSLVSSNPVVTSSVSKEPLRLTSNSIALSQEPAPSLS
PITKKLSDLTVSKPRLVTASPTTSPTPSGFKPVQLPKPASPKILDDTTPTATPTPTPTPT
PTPTPSPLDSEGYEKLQPGATLLHYARLDLPEIAGAPPVSPTPVQEGFTYAEIDFAKLKQ
N
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccccgtccgtggtccaatcgccggggcccgtcgtcctcgccgctcacctcaag
aagctcaagaccctcaagaagaagtacttcgtgctgcatgccgaggttctagggcatccc
gcctgcctcgagtactacgacagcaaaaagaagtacgagagcaggcaaccgcccaagcgt
agcatctccgtgcgcagctgcttcaatatcaacaaccgcacggacaccaagcacaagcat
gttatcgctctctacaccaaggacgactgcttctccctggtgctggaaaacgagaaggac
caggagcagtggctcaacgctctgctactcctgcagaatggtgaccagacagatggcgag
caaccacggcctacatttgagcacatctggcaggtgatcatgcagaagaagggactcgga
gagcgaaagaacatcactggtccctacagactgtgcctcacagaccgagttctcagcttg
gtcaagcttggagccgatgacaagtcggactctattgaattttccnnnnnnnnnnnnnnn
nnnnnnnnctggatggaagttgaggacaataacattgcgcagaacatgcacacagccatc
aacaatgctatgaccaactccagtagcaccaaggatgaaggtcccaggcagaggttgcgc
agttcctcagccaacgaagccagcaaacctatatcggttttgcagaggaggcacactgcg
cagaaactgcacagtttttcacctttagaggaacaaaggatgcacgaggatcaggtggca
ccattacaggagcagaacgtcactgcatctgccccctcacagggtagtcaaacacagact
acctctacttccaatacacatatggctgctgtcggtgtaacagagagcggaatcctgggg
acaagcgcctctactaaaagcagcgctgccatgacgaatagacgtcgacattcggtagca
agtcatccgatcccatccacaaccaataacaacatatcccaatccactcatgccaataca
acatcatcgtcgagcacaacaagcactaccgcaaccgcgacaatatcccatcagagaacc
ctgtcgctgcccttagccgctgttgctatcaatcaaacgcaatcatccaaaagatccgtg
ttacgctgcgttccaacggtgcgggacagatgcgatagtctgccatcgagagcgcgcaca
acgagcgagggtcatcccggtggtccagtcatcaccaccagcgtcatcagtaacagcgtc
atcacgaccatggcgcaacagtcattacagcacggcagagtggcctacctggcgccacac
gtgcccaggccacattcgatgcacagccgggtgctgtcgtactcgccgcccgtcgcctcg
atgcccatcagtccggcctctgccgcctgttccacggattcggctggatcctcgttgtcc
atggacgacgcgtccgagaatatcatggaggaggcggtcatatctaaatacgggcactcg
ctcacgcccgacgagcccgtcatcctcgaggagaacggcgacgactacgtgccctggtcc
gccagccaccagcaaaagtattcgcctaacttcaagtcctgctccccttcgcagcaaagt
tcctacgtcgagatgtacagcccgtgcagttcgagtcccgggcggggtgcgtacatgcca
atgagcccggcgacaggggcgcactcgcattcacggacttcgtcacttgtcgaggagagc
agcactttgccggacggctacgtgccgatggcaccggttggcgatcacggctacgtcgac
atggatccggccaacaaccacaacggtcacttccctgacgacatgtcgcagcacggtggc
agcagctgttctgttacctccggcacgcccagcacggatctgcgattctcggagtatcac
ctcgacaaggtcacgagtttcctcccacctggagaggacctgcaagcgaggcccaccagg
gcctactccgttggctcgcggcccgagcccgccaataggcatcgaaaaaatagactggaa
attgcccaacaagaagcaagcagagtgcgtgctttctctgtgggaagtcgatcgaaaagg
cctgaaatcggcaggcttgctaatgttgttactgctccactagtcgctggtattgagagt
tcgcactcgaacaagtcatattcggcgcctcttttatcaagttcatggggccatcaatcc
ggttgttccatcacttccgagcgcatggaagaccttatggaactggacttcactaggccc
aatggcccagttgcactctcgtcgcctccctcctcgtattcgcaatcgcaatcatattca
actgccaccgacaccagttcctacgtcgatatgtctcctggacagccgccaatatccacc
actgccccctatgttgacatgaacggaccaacaaagataaatcggaataataacaacagt
aacagcaacaataacaacaataataacaatattactactgccaatcacaatcacaatcat
tctttagtaatggtttctacacataaaccagtcataacgcaggtttcatcattattgaag
cctgtcgaagaaacggagtcgccctatatgagaatggataaaggtctcgaggattggact
cagtctagaataagtccaaaacaggttccgtcgccctgccaggacgactacatgcagatg
aacggacctcctggcggaaccagaactgcgcccatggacttgccacaacctcgacgtcct
cccgagggttacgttgaaatgtcgttcaaggccaaacctagtctcgagcaagactacata
aacatgagcatgggactaggtcgtaacaatcgcagacatcacaacaataatcgcaagaaa
aaatgctcgttgccaatcgcgattcaggctggcagcaagtcttccaagaccccaaatttt
ttgccgctcaatggcagtccaagttcagagagcctagcaagcacgccagcttctccgccg
cgggccacgccgaccggttcctctgccacgatattccctttctcgcttaacagtccccag
tcgcccgtcaagccattcaacacatcgcaagctggcactgataacaagtcttcctctgtc
ggggatgtatcttccacaaagaacgaaagtggcaatatcgtgccagttacaaggaaaatc
tcggcaccaagtcctctccccggagttgacggctgtccctcatcgaagaaggcccacgac
aaccctcccgacacatctgtgaactcgacgacgagaaatgttaccgtgacgagtaaacag
aatgatcccgtaagcctcgttagcagcaatccggttgtgacaagttccgtcagcaaagag
cctctgcggcttacttcgaattccatagctctgagtcaagagccagcaccttctctcagt
ccgatcacgaagaagctgtcagatctgacggtatcaaagccacgtcttgtaactgcatcg
ccgactacgagtcccacgccctccggtttcaagcctgtgcagcttccgaaacctgcctca
ccgaagatcttggacgacacgacgccaactgcaacacccacgcctacacctacacctacg
ccaacaccaacgcccagtcccctggatagcgagggttacgagaagctgcagcccggagca
actcttttgcactatgcgcgtctcgatttgcccgagattgccggagcgcctcctgtctcg
cctacccccgtccaggagggtttcacttacgcagaaatcgatttcgctaagctcaaacaa
aactag

DBGET integrated database retrieval system