KEGG   Nasonia vitripennis (jewel wasp): 100119908Help
Entry
100119908         CDS       T01081                                 

Definition
flocculation protein FLO11
Orthology
K16172  
insulin receptor substrate 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100119908
   04150 mTOR signaling pathway
    100119908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 1254 aa AA seqDB search
MSSPSVVQSPGPVVLAAHLKKLKTLKKKYFVLHAEVLGHPACLEYYDSKKKYESRQPPKR
SISVRSCFNINNRTDTKHKHVIALYTKDDCFSLVLENEKDQEQWLNALLLLQNGDQTDGE
QPRPTFEHIWQVIMQKKGLGERKNITGPYRLCLTDRVLSLVKLGADDKSDSIEFSVRMEV
EDNNIAQNMHTAINNAMTNSSSTKDEGPRQRLRSSSANEASKPISVLQRRHTAQKLHSFS
PLEEQRMHEDQVAPLQEQNVTASAPSQGSQTQTTSTSNTHMAAVGVTESGILGTSASTKS
SAAMTNRRRHSVASHPIPSTTNNNISQSTHANTTSSSSTTSTTATATISHQRTLSLPLAA
VAINQTQSSKRSVLRCVPTVRDRCDSLPSRARTTSEGHPGGPVITTSVISNSVITTMAQQ
SLQHGRVAYLAPHVPRPHSMHSRVLSYSPPVASMPISPASAACSTDSAGSSLSMDDASEN
IMEEAVISKYGHSLTPDEPVILEENGDDYVPWSASHQQKYSPNFKSCSPSQQSSYVEMYS
PCSSSPGRGAYMPMSPATGAHSHSRTSSLVEESSTLPDGYVPMAPVGDHGYVDMDPANNH
NGHFPDDMSQHGGSSCSVTSGTPSTDLRFSEYHLDKVTSFLPPGEDLQARPTRAYSVGSR
PEPANRHRKNRLEIAQQEASRVRAFSVGSRSKRPEIGRLANVVTAPLVAGIESSHSNKSY
SAPLLSSSWGHQSGCSITSERMEDLMELDFTRPNGPVALSSPPSSYSQSQSYSTATDTSS
YVDMSPGQPPISTTAPYVDMNGPTKINRNNNNSNSNNNNNNNNITTANHNHNHSLVMVST
HKPVITQVSSLLKPVEETESPYMRMDKGLEDWTQSRISPKQVPSPCQDDYMQMNGPPGGT
RTAPMDLPQPRRPPEGYVEMSFKAKPSLEQDYINMSMGLGRNNRRHHNNNRKKKCSLPIA
IQAGSKSSKTPNFLPLNGSPSSESLASTPASPPRATPTGSSATIFPFSLNSPQSPVKPFN
TSQAGTDNKSSSVGDVSSTKNESGNIVPVTRKISAPSPLPGVDGCPSSKKAHDNPPDTSV
NSTTRNVTVTSKQNDPVSLVSSNPVVTSSVSKEPLRLTSNSIALSQEPAPSLSPITKKLS
DLTVSKPRLVTASPTTSPTPSGFKPVQLPKPASPKILDDTTPTATPTPTPTPTPTPTPSP
LDSEGYEKLQPGATLLHYARLDLPEIAGAPPVSPTPVQEGFTYAEIDFAKLKQN
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccccgtccgtggtccaatcgccggggcccgtcgtcctcgccgctcacctcaag
aagctcaagaccctcaagaagaagtacttcgtgctgcatgccgaggttctagggcatccc
gcctgcctcgagtactacgacagcaaaaagaagtacgagagcaggcaaccgcccaagcgt
agcatctccgtgcgcagctgcttcaatatcaacaaccgcacggacaccaagcacaagcat
gttatcgctctctacaccaaggacgactgcttctccctggtgctggaaaacgagaaggac
caggagcagtggctcaacgctctgctactcctgcagaatggtgaccagacagatggcgag
caaccacggcctacatttgagcacatctggcaggtgatcatgcagaagaagggactcgga
gagcgaaagaacatcactggtccctacagactgtgcctcacagaccgagttctcagcttg
gtcaagcttggagccgatgacaagtcggactctattgaattttccgtgaggatggaagtt
gaggacaataacattgcgcagaacatgcacacagccatcaacaatgctatgaccaactcc
agtagcaccaaggatgaaggtcccaggcagaggttgcgcagttcctcagccaacgaagcc
agcaaacctatatcggttttgcagaggaggcacactgcgcagaaactgcacagtttttca
cctttagaggaacaaaggatgcacgaggatcaggtggcaccattacaggagcagaacgtc
actgcatctgccccctcacagggtagtcaaacacagactacctctacttccaatacacat
atggctgctgtcggtgtaacagagagcggaatcctggggacaagcgcctctactaaaagc
agcgctgccatgacgaatagacgtcgacattcggtagcaagtcatccgatcccatccaca
accaataacaacatatcccaatccactcatgccaatacaacatcatcgtcgagcacaaca
agcactaccgcaaccgcgacaatatcccatcagagaaccctgtcgctgcccttagccgct
gttgctatcaatcaaacgcaatcatccaaaagatccgtgttacgctgcgttccaacggtg
cgggacagatgcgatagtctgccatcgagagcgcgcacaacgagcgagggtcatcccggt
ggtccagtcatcaccaccagcgtcatcagtaacagcgtcatcacgaccatggcgcaacag
tcattacagcacggcagagtggcctacctggcgccacacgtgcccaggccacattcgatg
cacagccgggtgctgtcgtactcgccgcccgtcgcctcgatgcccatcagtccggcctct
gccgcctgttccacggattcggctggatcctcgttgtccatggacgacgcgtccgagaat
atcatggaggaggcggtcatatctaaatacgggcactcgctcacgcccgacgagcccgtc
atcctcgaggagaacggcgacgactacgtgccctggtccgccagccaccagcaaaagtat
tcgcctaacttcaagtcctgctccccttcgcagcaaagttcctacgtcgagatgtacagc
ccgtgcagttcgagtcccgggcggggtgcgtacatgccaatgagcccggcgacaggggcg
cactcgcattcacggacttcgtcacttgtcgaggagagcagcactttgccggacggctac
gtgccgatggcaccggttggcgatcacggctacgtcgacatggatccggccaacaaccac
aacggtcacttccctgacgacatgtcgcagcacggtggcagcagctgttctgttacctcc
ggcacgcccagcacggatctgcgattctcggagtatcacctcgacaaggtcacgagtttc
ctcccacctggagaggacctgcaagcgaggcccaccagggcctactccgttggctcgcgg
cccgagcccgccaataggcatcgaaaaaatagactggaaattgcccaacaagaagcaagc
agagtgcgtgctttctctgtgggaagtcgatcgaaaaggcctgaaatcggcaggcttgct
aatgttgttactgctccactagtcgctggtattgagagttcgcactcgaacaagtcatat
tcggcgcctcttttatcaagttcatggggccatcaatccggttgttccatcacttccgag
cgcatggaagaccttatggaactggacttcactaggcccaatggcccagttgcactctcg
tcgcctccctcctcgtattcgcaatcgcaatcatattcaactgccaccgacaccagttcc
tacgtcgatatgtctcctggacagccgccaatatccaccactgccccctatgttgacatg
aacggaccaacaaagataaatcggaataataacaacagtaacagcaacaataacaacaat
aataacaatattactactgccaatcacaatcacaatcattctttagtaatggtttctaca
cataaaccagtcataacgcaggtttcatcattattgaagcctgtcgaagaaacggagtcg
ccctatatgagaatggataaaggtctcgaggattggactcagtctagaataagtccaaaa
caggttccgtcgccctgccaggacgactacatgcagatgaacggacctcctggcggaacc
agaactgcgcccatggacttgccacaacctcgacgtcctcccgagggttacgttgaaatg
tcgttcaaggccaaacctagtctcgagcaagactacataaacatgagcatgggactaggt
cgtaacaatcgcagacatcacaacaataatcgcaagaaaaaatgctcgttgccaatcgcg
attcaggctggcagcaagtcttccaagaccccaaattttttgccgctcaatggcagtcca
agttcagagagcctagcaagcacgccagcttctccgccgcgggccacgccgaccggttcc
tctgccacgatattccctttctcgcttaacagtccccagtcgcccgtcaagccattcaac
acatcgcaagctggcactgataacaagtcttcctctgtcggggatgtatcttccacaaag
aacgaaagtggcaatatcgtgccagttacaaggaaaatctcggcaccaagtcctctcccc
ggagttgacggctgtccctcatcgaagaaggcccacgacaaccctcccgacacatctgtg
aactcgacgacgagaaatgttaccgtgacgagtaaacagaatgatcccgtaagcctcgtt
agcagcaatccggttgtgacaagttccgtcagcaaagagcctctgcggcttacttcgaat
tccatagctctgagtcaagagccagcaccttctctcagtccgatcacgaagaagctgtca
gatctgacggtatcaaagccacgtcttgtaactgcatcgccgactacgagtcccacgccc
tccggtttcaagcctgtgcagcttccgaaacctgcctcaccgaagatcttggacgacacg
acgccaactgcaacacccacgcctacacctacacctacgccaacaccaacgcccagtccc
ctggatagcgagggttacgagaagctgcagcccggagcaactcttttgcactatgcgcgt
ctcgatttgcccgagattgccggagcgcctcctgtctcgcctacccccgtccaggagggt
ttcacttacgcagaaatcgatttcgctaagctcaaacaaaactag

DBGET integrated database retrieval system