KEGG   Nasonia vitripennis (jewel wasp): 100119908Help
Entry
100119908         CDS       T01081                                 

Definition
(RefSeq) mucin-5AC
  KO
K16172  
insulin receptor substrate 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100119908
   04150 mTOR signaling pathway
    100119908
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100119908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 1282 aa AA seqDB search
MSSPSVVQSPGPVVLAAHLKKLKTLKKKYFVLHAEVLGHPACLEYYDSKKKYESRQPPKR
SISVRSCFNINNRTDTKHKHVIALYTKDDCFSLVLENEKDQEQWLNALLLLQNGDQTDGE
QPRPTFEHIWQVIMQKKGLGERKNITGPYRLCLTDRVLSLVKLGADDKSDSIEFSLSCIR
RSGCMDRIFYMEVGRSAIAGGGEFWMEVEDNNIAQNMHTAINNAMTNSSSTKDEGPRQRL
RSSSANEASKPISVLQRRHTAQKLHSFSPLEEQRMHEDQVAPLQEQNVTASAPSQGSQTQ
TTSTSNTHMAAVGVTESGILGTSASTKSSAAMTNRRRHSVASHPIPSTTNNNISQSTHAN
TTSSSSTTSTTATATISHQRTLSLPLAAVAINQTQSSKRSVLRCVPTVRDRCDSLPSRAR
TTSEGHPGGPVITTSVISNSVITTMAQQSLQHGRVAYLAPHVPRPHSMHSRVLSYSPPVA
SMPISPASAACSTDSAGSSLSMDDASENIMEEAVISKYGHSLTPDEPVILEENGDDYVPW
SASHQQKYSPNFKSCSPSQQSSYVEMYSPCSSSPGRGAYMPMSPATGAHSHSRTSSLVEE
SSTLPDGYVPMAPVGDHGYVDMDPANNHNGHFPDDMSQHGGSSCSVTSGTPSTDLRFSEY
HLDKVTSFLPPGEDLQARPTRAYSVGSRPEPANRHRKNRLEIAQQEASRVRAFSVGSRSK
RPEIGRLANVVTAPLVAGIESSHSNKSYSAPLLSSSWGHQSGCSITSERMEDLMELDFTR
PNGPVALSSPPSSYSQSQSYSTATDTSSYVDMSPGQPPISTTAPYVDMNGPTKINRNNNN
SNSNNNNNNNNITTANHNHNHSLVMVSTHKPVITQVSSLLKPVEETESPYMRMDKGLEDW
TQSRISPKQVPSPCQDDYMQMNGPPGGTRTAPMDLPQPRRPPEGYVEMSFKAKPSLEQDY
INMSMGLGRNNRRHHNNNRKKKCSLPIAIQAGSKSSKTPNFLPLNGSPSSESLASTPASP
PRATPTGSSATIFPFSLNSPQSPVKPFNTSQAGTDNKSSSVGDVSSTKNESGNIVPVTRK
ISAPSPLPGVDGCPSSKKAHDNPPDTSVNSTTRNVTVTSKQNDPVSLVSSNPVVTSSVSK
EPLRLTSNSIALSQEPAPSLSPITKKLSDLTVSKPRLVTASPTTSPTPSGFKPVQLPKPA
SPKILDDTTPTATPTPTPTPTPTPTPSPLDSEGYEKLQPGATLLHYARLDLPEIAGAPPV
SPTPVQEGFTYAEIDFAKLKQN
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccccgtccgtggtccaatcgccggggcccgtcgtcctcgccgctcacctcaag
aagctcaagaccctcaagaagaagtacttcgtgctgcatgccgaggttctagggcatccc
gcctgcctcgagtactacgacagcaaaaagaagtacgagagcaggcaaccgcccaagcgt
agcatctccgtgcgcagctgcttcaatatcaacaaccgcacggacaccaagcacaagcat
gttatcgctctctacaccaaggacgactgcttctccctggtgctggaaaacgagaaggac
caggagcagtggctcaacgctctgctactcctgcagaatggtgaccagacagatggcgag
caaccacggcctacatttgagcacatctggcaggtgatcatgcagaagaagggactcgga
gagcgaaagaacatcactggtccctacagactgtgcctcacagaccgagttctcagcttg
gtcaagcttggagccgatgacaagtcggactctattgaattttccttgagctgcataaga
cgctctggctgcatggaccgtatattctacatggaggtgggtcggtccgccattgcaggt
ggaggagagttctggatggaagttgaggacaataacattgcgcagaacatgcacacagcc
atcaacaatgctatgaccaactccagtagcaccaaggatgaaggtcccaggcagaggttg
cgcagttcctcagccaacgaagccagcaaacctatatcggttttgcagaggaggcacact
gcgcagaaactgcacagtttttcacctttagaggaacaaaggatgcacgaggatcaggtg
gcaccattacaggagcagaacgtcactgcatctgccccctcacagggtagtcaaacacag
actacctctacttccaatacacatatggctgctgtcggtgtaacagagagcggaatcctg
gggacaagcgcctctactaaaagcagcgctgccatgacgaatagacgtcgacattcggta
gcaagtcatccgatcccatccacaaccaataacaacatatcccaatccactcatgccaat
acaacatcatcgtcgagcacaacaagcactaccgcaaccgcgacaatatcccatcagaga
accctgtcgctgcccttagccgctgttgctatcaatcaaacgcaatcatccaaaagatcc
gtgttacgctgcgttccaacggtgcgggacagatgcgatagtctgccatcgagagcgcgc
acaacgagcgagggtcatcccggtggtccagtcatcaccaccagcgtcatcagtaacagc
gtcatcacgaccatggcgcaacagtcattacagcacggcagagtggcctacctggcgcca
cacgtgcccaggccacattcgatgcacagccgggtgctgtcgtactcgccgcccgtcgcc
tcgatgcccatcagtccggcctctgccgcctgttccacggattcggctggatcctcgttg
tccatggacgacgcgtccgagaatatcatggaggaggcggtcatatctaaatacgggcac
tcgctcacgcccgacgagcccgtcatcctcgaggagaacggcgacgactacgtgccctgg
tccgccagccaccagcaaaagtattcgcctaacttcaagtcctgctccccttcgcagcaa
agttcctacgtcgagatgtacagcccgtgcagttcgagtcccgggcggggtgcgtacatg
ccaatgagcccggcgacaggggcgcactcgcattcacggacttcgtcacttgtcgaggag
agcagcactttgccggacggctacgtgccgatggcaccggttggcgatcacggctacgtc
gacatggatccggccaacaaccacaacggtcacttccctgacgacatgtcgcagcacggt
ggcagcagctgttctgttacctccggcacgcccagcacggatctgcgattctcggagtat
cacctcgacaaggtcacgagtttcctcccacctggagaggacctgcaagcgaggcccacc
agggcctactccgttggctcgcggcccgagcccgccaataggcatcgaaaaaatagactg
gaaattgcccaacaagaagcaagcagagtgcgtgctttctctgtgggaagtcgatcgaaa
aggcctgaaatcggcaggcttgctaatgttgttactgctccactagtcgctggtattgag
agttcgcactcgaacaagtcatattcggcgcctcttttatcaagttcatggggccatcaa
tccggttgttccatcacttccgagcgcatggaagaccttatggaactggacttcactagg
cccaatggcccagttgcactctcgtcgcctccctcctcgtattcgcaatcgcaatcatat
tcaactgccaccgacaccagttcctacgtcgatatgtctcctggacagccgccaatatcc
accactgccccctatgttgacatgaacggaccaacaaagataaatcggaataataacaac
agtaacagcaacaataacaacaataataacaatattactactgccaatcacaatcacaat
cattctttagtaatggtttctacacataaaccagtcataacgcaggtttcatcattattg
aagcctgtcgaagaaacggagtcgccctatatgagaatggataaaggtctcgaggattgg
actcagtctagaataagtccaaaacaggttccgtcgccctgccaggacgactacatgcag
atgaacggacctcctggcggaaccagaactgcgcccatggacttgccacaacctcgacgt
cctcccgagggttacgttgaaatgtcgttcaaggccaaacctagtctcgagcaagactac
ataaacatgagcatgggactaggtcgtaacaatcgcagacatcacaacaataatcgcaag
aaaaaatgctcgttgccaatcgcgattcaggctggcagcaagtcttccaagaccccaaat
tttttgccgctcaatggcagtccaagttcagagagcctagcaagcacgccagcttctccg
ccgcgggccacgccgaccggttcctctgccacgatattccctttctcgcttaacagtccc
cagtcgcccgtcaagccattcaacacatcgcaagctggcactgataacaagtcttcctct
gtcggggatgtatcttccacaaagaacgaaagtggcaatatcgtgccagttacaaggaaa
atctcggcaccaagtcctctccccggagttgacggctgtccctcatcgaagaaggcccac
gacaaccctcccgacacatctgtgaactcgacgacgagaaatgttaccgtgacgagtaaa
cagaatgatcccgtaagcctcgttagcagcaatccggttgtgacaagttccgtcagcaaa
gagcctctgcggcttacttcgaattccatagctctgagtcaagagccagcaccttctctc
agtccgatcacgaagaagctgtcagatctgacggtatcaaagccacgtcttgtaactgca
tcgccgactacgagtcccacgccctccggtttcaagcctgtgcagcttccgaaacctgcc
tcaccgaagatcttggacgacacgacgccaactgcaacacccacgcctacacctacacct
acgccaacaccaacgcccagtcccctggatagcgagggttacgagaagctgcagcccgga
gcaactcttttgcactatgcgcgtctcgatttgcccgagattgccggagcgcctcctgtc
tcgcctacccccgtccaggagggtttcacttacgcagaaatcgatttcgctaagctcaaa
caaaactag

DBGET integrated database retrieval system