KEGG   Nasonia vitripennis (jewel wasp): 100119940Help
Entry
100119940         CDS       T01081                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nvi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 377 aa AA seqDB search
MGVSSKMSEHNPEMRATAARICRDYLHGVWKHVTPDNIVLKRISGGLSNWLYNVQLPEGA
IPVRGEPRQVLLRLYGQVHGERAFEGLITESVIFTLLSERRLGPKLHGIFPGGRIEEYIP
ARPLLTKELADPCISSLIAEKMAQIHTMQVPISKEPTWLWDTMYKWLDTATNILENVEDI
ESKQLDHVTFIKSIDLEQEISWFRSLVKQQKHPVVFCHNDMQEGNILMRQNSKTELVVID
FEYCSYNYRGFDVANHFLEWQYDYTSADYPFFTERSGSGSTKEQKLNFIRSYLRSAGKEG
QAEEDRMMAEIKLFSLASDLFWGLWSIVNAKLSQIPFGYWDYAVARLRHYQYLKEKILVS
GPHFPDGGVKRKVTQLD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcagcagcaagatgtctgagcacaacccggaaatgagggctacagcagcgcgc
atttgccgtgattatttgcatggagtatggaagcacgttaccccagacaacattgttctg
aagaggattagcggtggtctgagcaactggctatacaatgtccaattacccgagggcgcg
ataccggttcgtggcgagcccagacaggttcttctgcgactctacggtcaagtgcatggc
gagcgagccttcgagggcctgatcaccgaatccgtcatcttcacacttctttcagagagg
cggcttggtcccaagcttcacggtatcttccccggtggcaggatcgaggagtacatacca
gctcgtcccttactcactaaagagttggctgatccttgcatcagttcgctcatcgccgag
aaaatggcacagatacacacgatgcaggtgcccatcagcaaggaacccacttggctctgg
gatacgatgtacaagtggctggacaccgcgacgaacatactggaaaacgtcgaggatatc
gaaagcaaacaacttgatcacgtgaccttcatcaaaagcatcgatctggaacaggagata
tcctggttcagatcgctagtcaaacaacaaaagcatcctgttgtcttctgtcataacgac
atgcaggagggcaacattcttatgcgacaaaactcgaagactgaactcgtggtcatcgac
tttgaatactgttcttacaactacaggggcttcgatgtggcaaaccacttcctcgaatgg
cagtacgactacacgtcggcggactatccattcttcaccgagagatcgggctccggatcc
accaaagagcaaaagctcaatttcataagaagttacttgcgaagtgctggaaaagaggga
caggcagaggaagatcgcatgatggcagagattaagctgttctccctcgctagcgacttg
ttctggggactgtggagtatcgtcaacgccaagctctctcaaattccattcggatactgg
gattacgccgttgcaaggctgaggcactaccagtacctgaaggagaagatcctggtgtcg
ggcccgcacttccccgacggcggggtcaagagaaaagtgacacagctggattga

DBGET integrated database retrieval system