KEGG   Nasonia vitripennis (jewel wasp): 100120014Help
Entry
100120014         CDS       T01081                                 

Gene name
Setdb1
Definition
SET domain, bifurcated 1
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nvi00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 1121 aa AA seqDB search
MAKEAEVIDLDSDEDVKDVKDVKERRKPGNVNCINFKCTSGESMKPAPSFACSFYSVNMT
KKKKRFICQVCLDDALDHQDILVTAVLEHKPLLQCEFPDHTMEVEISDSDESDNETKNDQ
DNYVLEDVLAEFERKVDISLGDVMKKYDINYQVEEATKALKAEWDGVDASHKELDATINQ
TMLKLDKIRSTLYYEFKPNIQMLEELKIEDSIGHINYPAVATKKVTQVRPPVNKTQPQDN
QPEILQEVERDNRLIQSMDLPPSGHLIKPVPEVDDYVFTMKHPLFPWIKGKVQSIISKNP
MQYRVKLLQKKYAGQVKTLTGKQMASSTPSPVIIPVTTRVVAIFQDSYSSNYYSGVIAEP
PKSTNKYRYLVFFDDGYAQYVKHKHIFLVCESSPRVWEDIPMESRDFVKKYMDSYPERPM
VKLQRGQVVKTEWNGKWWIARVREVDASLVQMHFDADNRTEWIYRGSARLGPLYLELMKA
NLRQQGCHSSINTPSRHRGVSAMNKNGPYVEYTSTATDERDAILSKDKQSVIVPDTPQTG
TIAPPTQSRAVAKKSTVKRPVVPESSTIPTTSTTSSYHGMPTAMETKSSHSIVYYQTQNK
IQTKKFVPHKCGPKCVESISFTPDDLRGYSPLSIPLLCGWNRQLCKFPKAKKVILYQAPC
GVRLRNMEELHRYLRMTNCPMSVDLFEFDFWVHCLAEFVLDKCFVNIKDLSYGVENVPIP
CVNEIDHAYPDTIKYTTQREPTEDVYMNLDPDFLCSCDCEDDCQDKNKCQCWQLTIQGAT
LGGRVPNAAVGYVYKRLPEAVTTGIYECNSRCKCSVKTCLNRVVQHPLNLKLQVFKTAPR
GWGIRCLNDIPLGSFICIYAGRLLTEQGANEGGKNYGDEYLAELDYVEVVEGIKEGYESD
VLEPEIEPPEDENNEKEKSDKKLEDKTYVPTPGSNDSDDDYNVSKKLQKNLNIEEDEDST
SSIRSRLRKRTKGGENQGSDKGSEDGSVSKDGQDKAGSDDEEAIRQPQKFDLTVDTTQIG
REKFKSVRDFFGEDEAVYIMDAKTTGNIGRYLNHSCDPNVFVQNVFVDTHDVRFPWVAFF
ALSYIRAGQELTWNYSYDVGSIPGKVIICKCGASNCRGRLL
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaagcagaagttatagacttggactcggacgaagatgtgaaagacgtgaaa
gacgtgaaggagaggagaaaaccgggcaatgtcaattgtatcaattttaaatgtacctcg
ggcgagagtatgaaacccgcgccgtcgtttgcctgttcgttttattctgttaacatgacg
aagaagaagaaacgtttcatctgtcaagtttgtctggacgatgccttggatcaccaggat
atactcgttaccgctgtgttggagcacaaaccactgctccaatgcgaatttccagatcat
acaatggaagttgagatttccgacagcgatgagtctgataatgaaacaaagaacgaccag
gataactatgtattagaagatgtcttggctgaatttgagagaaaagtcgatatttcctta
ggagatgtgatgaaaaagtatgacataaattatcaggtagaagaggctactaaagcactg
aaagctgaatgggatggtgttgacgcaagccacaaagaattggatgcaaccatcaatcag
accatgcttaaattggataaaatacgttccacactctattatgaattcaagccaaatatc
caaatgcttgaagaattgaaaatagaagattctatagggcatatcaactatcctgcagta
gcaacaaagaaagtcactcaagttcgaccaccagttaacaaaacacagccacaagacaat
caaccagaaatcttgcaagaagtggaaagagacaatcgtttaattcaatctatggaccta
ccaccttcaggacatttgattaaaccagttccagaagtagatgactatgtgttcacaatg
aaacatcctctgtttccatggatcaaaggaaaagttcaaagtatcatttccaaaaatcca
atgcaatatcgtgttaaactattgcaaaagaagtatgctggtcaggtaaaaacactgacc
ggcaaacaaatggcttccagcacccccagtccagtaatcattccagttaccacgcgagtg
gttgctattttccaagatagctattccagcaactactacagtggtgtaatcgctgagcct
ccgaaatccacaaacaaatatagatatctcgttttcttcgacgacggttacgcgcagtac
gtcaagcacaagcacatattcctagtctgtgaaagttcaccccgcgtgtgggaggacata
cccatggagtctcgtgactttgtcaaaaaatacatggattcctatccagagagacctatg
gtgaagctgcaacgtggtcaggtcgtcaagaccgagtggaacggaaagtggtggatagcg
cgagtcagggaagttgacgccagtttagtccagatgcatttcgatgcggataacaggaca
gagtggatttacagaggttcagcgaggctgggtccgctgtacctggagttgatgaaagcc
aatttgagacagcaaggttgtcattcgtctatcaatacgccgagtcgccaccgtggtgtt
tcagcgatgaacaaaaatggtccatacgtcgaatacacgtcgaccgccacagacgaaaga
gatgcgatactatccaaggacaagcagtcagtcatagtacctgatactcctcagacagga
actatagctcctccaacgcaaagcagagccgtagccaaaaaaagtactgtcaagagaccc
gttgtgcccgaatcgtcgacgataccgacgacgtcgacgacttcctcctatcacggcatg
ccaactgctatggagaccaagtcttcccacagtatcgtctactaccaaacccaaaacaaa
atccagacaaagaagttcgtgcctcacaaatgtggtcccaagtgcgtggaaagtatctcc
tttacaccagatgatcttcgtggctactcgccgctatctatcccgctgctctgcgggtgg
aaccggcagctttgcaaatttccaaaagccaagaaagtcatcctgtaccaggcaccctgt
ggagtgcgtcttcgaaatatggaggagctgcatcgctatcttcgtatgaccaactgtccc
atgtctgtcgacctcttcgagttcgacttctgggtccattgtctggcagagtttgtcctc
gacaagtgttttgttaatatcaaggacttgagttacggagtggagaacgtaccgataccc
tgcgtgaacgaaatagatcacgcttatccagataccataaagtatacaacgcaacgcgaa
ccgacggaggacgtttatatgaacttggatccagatttcctttgcagctgtgattgcgaa
gatgactgccaagacaaaaacaaatgtcagtgttggcagttgacgatccaaggcgcgact
ctcggtggccgagttccaaatgccgctgtcggatacgtgtacaagagattgcctgaggct
gtgaccactggaatctacgagtgcaattccaggtgcaagtgttcggtaaagacatgtctg
aaccgagttgtacaacaccccttgaatctcaaacttcaagtcttcaaaacagcccctcga
ggctggggtatcaggtgcctgaacgatattcccctaggctcgtttatctgcatctatgca
ggtcgtcttctcaccgaacaaggtgccaacgaaggtggtaaaaactacggagacgagtac
ttggcagaactcgactacgtcgaggtcgtcgagggcatcaaagagggctacgaaagtgac
gtcctcgagcccgaaatagaaccaccagaggatgagaacaacgagaaggagaaatccgac
aagaaattggaagacaagacgtatgtgcccacacctggatcgaatgattccgatgacgat
tataacgtcagtaagaagctgcagaaaaatttgaatattgaagaggatgaggattctacg
tcgtctataaggagtcggctaagaaagcgaaccaaaggaggtgaaaatcagggctctgac
aaaggatctgaggacggcagcgtatcgaaagacggacaggataaggctggcagcgatgac
gaggaggcaatacgccagccacaaaagttcgatctaacggttgatacaacgcaaatcgga
agggagaaattcaaatccgtcagagactttttcggcgaagatgaggcggtgtacattatg
gacgccaagacgacgggaaatatcggacgctatctgaatcactcctgtgacccgaatgta
ttcgtccagaacgtatttgtggacactcacgacgttcgatttccctgggtggcattcttt
gcattgagctatattagagcgggacaagaattaacttggaactatagctacgacgttgga
agtattcccggaaaggtgatcatttgcaaatgtggagcaagtaactgcagaggccgtttg
ttgtaa

DBGET integrated database retrieval system