KEGG   Nasonia vitripennis (jewel wasp): 100120014Help
Entry
100120014         CDS       T01081                                 

Gene name
Setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100120014 (Setdb1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100120014 (Setdb1)
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100120014 (Setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100120014 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 1121 aa AA seqDB search
MAKEAEVIDLDSDEDVKDVKDVKERRKPGNVNCINFKCTSGESMKPAPSFACSFYSVNMT
KKKKRFICQVCLDDALDHQDILVTAVLEHKPLLQCEFPDHTMEVEISDSDESDNETKNDQ
DNYVLEDVLAEFERKVDISLGDVMKKYDINYQVEEATKALKAEWDGVDASHKELDATINQ
TMLKLDKIRSTLYYEFKPNIQMLEELKIEDSIGHINYPAVATKKVTQVRPPVNKTQPQDN
QPEILQEVERDNRLIQSMDLPPSGHLIKPVPEVDDYVFTMKHPLFPWIKGKVQSIISKNP
MQYRVKLLQKKYAGQVKTLTGKQMASSTPSPVIIPVTTRVVAIFQDSYSSNYYSGVIAEP
PKSTNKYRYLVFFDDGYAQYVKHKHIFLVCESSPRVWEDIPMESRDFVKKYMDSYPERPM
VKLQRGQVVKTEWNGKWWIARVREVDASLVQMHFDADNRTEWIYRGSARLGPLYLELMKA
NLRQQGCHSSINTPSRHRGVSAMNKNGPYVEYTSTATDERDAILSKDKQSVIVPDTPQTG
TIAPPTQSRAVAKKSTVKRPVVPESSTIPTTSTTSSYHGMPTAMETKSSHSIVYYQTQNK
IQTKKFVPHKCGPKCVESISFTPDDLRGYSPLSIPLLCGWNRQLCKFPKAKKVILYQAPC
GVRLRNMEELHRYLRMTNCPMSVDLFEFDFWVHCLAEFVLDKCFVNIKDLSYGVENVPIP
CVNEIDHAYPDTIKYTTQREPTEDVYMNLDPDFLCSCDCEDDCQDKNKCQCWQLTIQGAT
LGGRVPNAAVGYVYKRLPEAVTTGIYECNSRCKCSVKTCLNRVVQHPLNLKLQVFKTAPR
GWGIRCLNDIPLGSFICIYAGRLLTEQGANEGGKNYGDEYLAELDYVEVVEGIKEGYESD
VLEPEIEPPEDENNEKEKSDKKLEDKTYVPTPGSNDSDDDYNVSKKLQKNLNIEEDEDST
SSIRSRLRKRTKGGENQGSDKGSEDGSVSKDGQDKAGSDDEEAIRQPQKFDLTVDTTQIG
REKFKSVRDFFGEDEAVYIMDAKTTGNIGRYLNHSCDPNVFVQNVFVDTHDVRFPWVAFF
ALSYIRAGQELTWNYSYDVGSIPGKVIICKCGASNCRGRLL
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaagcagaagttatagacttggactcggacgaagatgtgaaagacgtgaaa
gacgtgaaggagaggagaaaaccgggcaatgtcaattgtatcaattttaaatgtacctcg
ggcgagagtatgaaacccgcgccgtcgtttgcctgttcgttttattctgttaacatgacg
aagaagaagaaacgtttcatctgtcaagtttgtctggacgatgccttggatcaccaggat
atactcgttaccgctgtgttggagcacaaaccactgctccaatgcgaatttccagatcat
acaatggaagttgagatttccgacagcgatgagtctgataatgaaacaaagaacgaccag
gataactatgtattagaagatgtcttggctgaatttgagagaaaagtcgatatttcctta
ggagatgtgatgaaaaagtatgacataaattatcaggtagaagaggctactaaagcactg
aaagctgaatgggatggtgttgacgcaagccacaaagaattggatgcaaccatcaatcag
accatgcttaaattggataaaatacgttccacactctattatgaattcaagccaaatatc
caaatgcttgaagaattgaaaatagaagattctatagggcatatcaactatcctgcagta
gcaacaaagaaagtcactcaagttcgaccaccagttaacaaaacacagccacaagacaat
caaccagaaatcttgcaagaagtggaaagagacaatcgtttaattcaatctatggaccta
ccaccttcaggacatttgattaaaccagttccagaagtagatgactatgtgttcacaatg
aaacatcctctgtttccatggatcaaaggaaaagttcaaagtatcatttccaaaaatcca
atgcaatatcgtgttaaactattgcaaaagaagtatgctggtcaggtaaaaacactgacc
ggcaaacaaatggcttccagcacccccagtccagtaatcattccagttaccacgcgagtg
gttgctattttccaagatagctattccagcaactactacagtggtgtaatcgctgagcct
ccgaaatccacaaacaaatatagatatctcgttttcttcgacgacggttacgcgcagtac
gtcaagcacaagcacatattcctagtctgtgaaagttcaccccgcgtgtgggaggacata
cccatggagtctcgtgactttgtcaaaaaatacatggattcctatccagagagacctatg
gtgaagctgcaacgtggtcaggtcgtcaagaccgagtggaacggaaagtggtggatagcg
cgagtcagggaagttgacgccagtttagtccagatgcatttcgatgcggataacaggaca
gagtggatttacagaggttcagcgaggctgggtccgctgtacctggagttgatgaaagcc
aatttgagacagcaaggttgtcattcgtctatcaatacgccgagtcgccaccgtggtgtt
tcagcgatgaacaaaaatggtccatacgtcgaatacacgtcgaccgccacagacgaaaga
gatgcgatactatccaaggacaagcagtcagtcatagtacctgatactcctcagacagga
actatagctcctccaacgcaaagcagagccgtagccaaaaaaagtactgtcaagagaccc
gttgtgcccgaatcgtcgacgataccgacgacgtcgacgacttcctcctatcacggcatg
ccaactgctatggagaccaagtcttcccacagtatcgtctactaccaaacccaaaacaaa
atccagacaaagaagttcgtgcctcacaaatgtggtcccaagtgcgtggaaagtatctcc
tttacaccagatgatcttcgtggctactcgccgctatctatcccgctgctctgcgggtgg
aaccggcagctttgcaaatttccaaaagccaagaaagtcatcctgtaccaggcaccctgt
ggagtgcgtcttcgaaatatggaggagctgcatcgctatcttcgtatgaccaactgtccc
atgtctgtcgacctcttcgagttcgacttctgggtccattgtctggcagagtttgtcctc
gacaagtgttttgttaatatcaaggacttgagttacggagtggagaacgtaccgataccc
tgcgtgaacgaaatagatcacgcttatccagataccataaagtatacaacgcaacgcgaa
ccgacggaggacgtttatatgaacttggatccagatttcctttgcagctgtgattgcgaa
gatgactgccaagacaaaaacaaatgtcagtgttggcagttgacgatccaaggcgcgact
ctcggtggccgagttccaaatgccgctgtcggatacgtgtacaagagattgcctgaggct
gtgaccactggaatctacgagtgcaattccaggtgcaagtgttcggtaaagacatgtctg
aaccgagttgtacaacaccccttgaatctcaaacttcaagtcttcaaaacagcccctcga
ggctggggtatcaggtgcctgaacgatattcccctaggctcgtttatctgcatctatgca
ggtcgtcttctcaccgaacaaggtgccaacgaaggtggtaaaaactacggagacgagtac
ttggcagaactcgactacgtcgaggtcgtcgagggcatcaaagagggctacgaaagtgac
gtcctcgagcccgaaatagaaccaccagaggatgagaacaacgagaaggagaaatccgac
aagaaattggaagacaagacgtatgtgcccacacctggatcgaatgattccgatgacgat
tataacgtcagtaagaagctgcagaaaaatttgaatattgaagaggatgaggattctacg
tcgtctataaggagtcggctaagaaagcgaaccaaaggaggtgaaaatcagggctctgac
aaaggatctgaggacggcagcgtatcgaaagacggacaggataaggctggcagcgatgac
gaggaggcaatacgccagccacaaaagttcgatctaacggttgatacaacgcaaatcgga
agggagaaattcaaatccgtcagagactttttcggcgaagatgaggcggtgtacattatg
gacgccaagacgacgggaaatatcggacgctatctgaatcactcctgtgacccgaatgta
ttcgtccagaacgtatttgtggacactcacgacgttcgatttccctgggtggcattcttt
gcattgagctatattagagcgggacaagaattaacttggaactatagctacgacgttgga
agtattcccggaaaggtgatcatttgcaaatgtggagcaagtaactgcagaggccgtttg
ttgtaa

DBGET integrated database retrieval system