KEGG   Nasonia vitripennis (jewel wasp): 100120093Help
Entry
100120093         CDS       T01081                                 

Definition
uncharacterized LOC100120093
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100120093
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100120093
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100120093
Enzymes [BR:nvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100120093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 517 aa AA seqDB search
MMMKPPSSVFQLPGFLRRCSNLNSFHTKLNTKLKPHTEGEENAINKDLEEIIDFKTRNTS
SWVIETKVNSLCLKYNILTKDERAKFLSSLATRYAVNHDKICQLAKRLACNEPNNPNQLI
SRERALKDALTPPYHWLFARVGRLEHGVKFLVDLRANVLDLISHCTKDSEDILHLSQMDA
TLKQMLFLWFSVGFMKVERVTWQTSCDILQKVSDYEAIHPVRNWADLKKRVGPYRRCFIF
THPSMPREPLVLLHTALCDVIPDSVKGIQDAENRILGKVIVNKERVEEDKTKIKAAIFYS
ISSTQVGLQGIELGNYLIKEVAKHITAEFPMIDQLSSLSPIPNFRVWLLDRMKRDINTVF
TKTEQESIKYNLDYDQTITATRDLHLDLKKIFNNSLWGNDKRLSSTLREPMLRACAFYLY
KEKRRNYALNNVANFHLRNGAVMWRINWMADPSPRGMANSCGIMVNYRYFLDETELNSRN
YIEKYHIKASNTVIHLANEAEKFFSTKVATAKEAVEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaagccaccaagctccgttttccaactgcctggatttctacgacgctgcagt
aatctaaactcttttcatacaaaattaaatacaaagctaaaacctcacacagagggggaa
gagaatgctatcaacaaagatctcgaggaaattatagacttcaaaacaagaaatactagc
agctgggtcatagaaacaaaagtgaacagtctgtgtttaaaatataatattttaacaaag
gatgagcgagccaagtttctatcgtctcttgcaactcgatatgctgtaaaccacgacaaa
atatgccagcttgcaaaaagattagcttgcaacgagccaaacaatccaaaccaactgatc
tcaagagagcgagctctaaaagatgccctaacacctccgtatcattggctgtttgcacga
gttggaagactggaacatggagtcaaatttcttgtagatttaagagcaaatgtcttagat
ttaataagccattgtacaaaggattcagaagatattttacatcttagtcagatggatgcc
actctgaaacaaatgttatttttgtggttttctgtaggatttatgaaagttgaacgggtg
acttggcaaacctcgtgtgacattttacaaaaagtttctgactatgaagctattcaccct
gtgaggaactgggctgatttaaaaaaacgagttgggccatacagaagatgttttattttt
actcatccatcaatgcccagagaacctctagttctactgcacactgctctatgtgatgtt
atacctgattcagtaaaaggtattcaagatgctgaaaatcgaattcttggtaaagttata
gttaataaagaaagagttgaagaggataagactaaaataaaagcagctatattttattct
atatcgtcaactcaagttggtctacaaggcattgagttgggaaattatttgataaaagaa
gtagcaaaacatataactgcagaattcccaatgatagaccaactttctagtttatcacct
ataccaaatttccgagtatggcttctagatagaatgaaaagagatatcaatacagttttt
actaaaactgagcaagagtcgataaaatataatttggactatgatcaaacaattacggca
acaagagatctgcatttagatttaaaaaagattttcaacaattctctttggggaaatgac
aaaagattatcgtcaactttgcgagaaccgatgttgcgagcttgcgcattctatttatac
aaagaaaaacggcgaaattatgctctaaataatgttgctaattttcatcttcgaaatgga
gccgttatgtggagaataaattggatggctgatccatcaccaagaggaatggcaaacagt
tgtggtatcatggttaattacagatactttttagatgagactgagttaaacagcagaaac
tatatagaaaaatatcacatcaaagcttctaacactgtaattcatttagcaaacgaagct
gaaaagttcttttctaccaaagttgcaactgccaaagaagcagtggaagaataa

DBGET integrated database retrieval system