KEGG   Nasonia vitripennis (jewel wasp): 100120288Help
Entry
100120288         CDS       T01081                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100120288
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100120288
Peptidases [BR:nvi01002]
 Metallo Peptidases
  Family M67
   100120288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 414 aa AA seqDB search
MEREKDKSDVKSHKQSLRNDMPKLISPETRLQHCFDTGKKFSFEVNNSIMRYYRSGKELI
RQADVYTKEGDLEKGYILYIRCLTIFLEKLETHPEYHTIPANDKDHIKNTLKEIFPKTEA
LKKKLLEQYKHEYAKQKQEYEEQERIELERLRQEQQRLKEEEEERALQLNSSAHSGALKL
GVAAGALTSADEFRLKRHVIPPKTYVPSQYDEQAQSSKDRKVPSVDRSTKPTSLTSGDRL
RDIVVPSKLMQNFLKLAFSNTSNNIETCGILAGRLERNRLLVTHFLIPKQTGSPDSCVTH
NEEDIFDFQDQHNLITLGWIHTHPTQTAFLSSVDLHTHCAYQLMMAEAIAIVCAPKYDET
GFFHLTPDYGLNYIANCRETGFHPHPSEPPLFTTAKHFILDPLAPIEAVDLRRK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaagataaatcagatgtgaaaagtcataaacaatcattaagaaatgat
atgccaaagttgatttctccagaaactcgattacagcactgctttgacactgggaaaaag
ttttcctttgaagtgaataattcgatcatgagatattatcgatcaggaaaagaattaatt
cgacaagcagatgtatacacaaaagagggagatttggagaaaggatatattctatatata
agatgtttaacaatttttctggaaaaattagaaactcatcccgagtaccatacgatccca
gctaatgataaagatcatataaagaacactttgaaagaaatatttccaaagactgaagct
ctgaagaaaaaacttttggaacaatataaacatgaatatgcaaaacaaaaacaggagtat
gaagaacaagaaagaatagaactcgaaaggcttagacaagagcaacaaagactgaaagaa
gaagaagaagaacgagcactacaattaaattcttcagcacactcaggagctcttaaactc
ggagtagctgctggagcattaacatctgcagatgaattcagattgaaacgtcatgttata
ccccctaaaacatatgtaccgtctcaatacgatgagcaagcccaatcttcgaaagataga
aaagtaccatccgttgatcgctcgactaaaccaacatcgctgacatcaggtgacagactt
agagacatagtagtaccaagcaaattaatgcaaaatttcttgaaattggccttcagtaat
acctctaataatattgaaacctgcgggatattggctggaagattagaaagaaacagatta
ctagtaacccatttcttgataccaaagcaaactggttctcccgactcttgcgtcacacac
aatgaagaggacatctttgattttcaagatcaacataatttgattactcttggatggatc
catacacatccaacacaaacggcgtttctatccagcgtagatctgcatactcactgtgct
taccaacttatgatggctgaagcaattgcaatagtttgtgctccaaaatatgatgagacc
ggctttttccacttgacaccagattatggtttgaactatatagctaattgcagagaaact
ggttttcatccgcacccttctgaaccaccattattcactactgcaaaacattttatattg
gaccctctggcacctatagaagctgttgatttacgaagaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system