KEGG   Nasonia vitripennis (jewel wasp): 100120288Help
Entry
100120288         CDS       T01081                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:nvi04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 414 aa AA seqDB search
MEREKDKSDVKSHKQSLRNDMPKLISPETRLQHCFDTGKKFSFEVNNSIMRYYRSGKELI
RQADVYTKEGDLEKGYILYIRCLTIFLEKLETHPEYHTIPANDKDHIKNTLKEIFPKTEA
LKKKLLEQYKHEYAKQKQEYEEQERIELERLRQEQQRLKEEEEERALQLNSSAHSGALKL
GVAAGALTSADEFRLKRHVIPPKTYVPSQYDEQAQSSKDRKVPSVDRSTKPTSLTSGDRL
RDIVVPSKLMQNFLKLAFSNTSNNIETCGILAGRLERNRLLVTHFLIPKQTGSPDSCVTH
NEEDIFDFQDQHNLITLGWIHTHPTQTAFLSSVDLHTHCAYQLMMAEAIAIVCAPKYDET
GFFHLTPDYGLNYIANCRETGFHPHPSEPPLFTTAKHFILDPLAPIEAVDLRRK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaagataaatcagatgtgaaaagtcataaacaatcattaagaaatgat
atgccaaagttgatttctccagaaactcgattacagcactgctttgacactgggaaaaag
ttttcctttgaagtgaataattcgatcatgagatattatcgatcaggaaaagaattaatt
cgacaagcagatgtatacacaaaagagggagatttggagaaaggatatattctatatata
agatgtttaacaatttttctggaaaaattagaaactcatcccgagtaccatacgatccca
gctaatgataaagatcatataaagaacactttgaaagaaatatttccaaagactgaagct
ctgaagaaaaaacttttggaacaatataaacatgaatatgcaaaacaaaaacaggagtat
gaagaacaagaaagaatagaactcgaaaggcttagacaagagcaacaaagactgaaagaa
gaagaagaagaacgagcactacaattaaattcttcagcacactcaggagctcttaaactc
ggagtagctgctggagcattaacatctgcagatgaattcagattgaaacgtcatgttata
ccccctaaaacatatgtaccgtctcaatacgatgagcaagcccaatcttcgaaagataga
aaagtaccatccgttgatcgctcgactaaaccaacatcgctgacatcaggtgacagactt
agagacatagtagtaccaagcaaattaatgcaaaatttcttgaaattggccttcagtaat
acctctaataatattgaaacctgcgggatattggctggaagattagaaagaaacagatta
ctagtaacccatttcttgataccaaagcaaactggttctcccgactcttgcgtcacacac
aatgaagaggacatctttgattttcaagatcaacataatttgattactcttggatggatc
catacacatccaacacaaacggcgtttctatccagcgtagatctgcatactcactgtgct
taccaacttatgatggctgaagcaattgcaatagtttgtgctccaaaatatgatgagacc
ggctttttccacttgacaccagattatggtttgaactatatagctaattgcagagaaact
ggttttcatccgcacccttctgaaccaccattattcactactgcaaaacattttatattg
gaccctctggcacctatagaagctgttgatttacgaagaaaatga

DBGET integrated database retrieval system