KEGG   Nasonia vitripennis (jewel wasp): 100120288Help
Entry
100120288         CDS       T01081                                 

Definition
(RefSeq) STAM-binding protein-like A
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100120288
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100120288
Peptidases [BR:nvi01002]
 Metallo Peptidases
  Family M67
   100120288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 414 aa AA seqDB search
MEREKDKSDVKSHKQSLRNDMPKLISPETRLQHCFDTGKKFSFEVNNSIMRYYRSGKELI
RQADVYTKEGDLEKGYILYIRCLTIFLEKLETHPEYHTIPANDKDHIKNTLKEIFPKTEA
LKKKLLEQYKHEYAKQKQEYEEQERIELERLRQEQQRLKEEEEERALQLNSSAHSGALKL
GVAAGALTSADEFRLKRHVIPPKTYVPSQYDEQAQSSKDRKVPSVDRSTKPTSLTSGDRL
RDIVVPSKLMQNFLKLAFSNTSNNIETCGILAGRLERNRLLVTHFLIPKQTGSPDSCVTH
NEEDIFDFQDQHNLITLGWIHTHPTQTAFLSSVDLHTHCAYQLMMAEAIAIVCAPKYDET
GFFHLTPDYGLNYIANCRETGFHPHPSEPPLFTTAKHFILDPLAPIEAVDLRRK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaagataaatcagatgtgaaaagtcataaacaatcattaagaaatgat
atgccaaagttgatttctccagaaactcgattacagcactgctttgacactgggaaaaag
ttttcctttgaagtgaataattcgatcatgagatattatcgatcaggaaaagaattaatt
cgacaagcagatgtatacacaaaagagggagatttggagaaaggatatattctatatata
agatgtttaacaatttttctggaaaaattagaaactcatcccgagtaccatacgatccca
gctaatgataaagatcatataaagaacactttgaaagaaatatttccaaagactgaagct
ctgaagaaaaaacttttggaacaatataaacatgaatatgcaaaacaaaaacaggagtat
gaagaacaagaaagaatagaactcgaaaggcttagacaagagcaacaaagactgaaagaa
gaagaagaagaacgagcactacaattaaattcttcagcacactcaggagctcttaaactc
ggagtagctgctggagcattaacatctgcagatgaattcagattgaaacgtcatgttata
ccccctaaaacatatgtaccgtctcaatacgatgagcaagcccaatcttcgaaagataga
aaagtaccatccgttgatcgctcgactaaaccaacatcgctgacatcaggtgacagactt
agagacatagtagtaccaagcaaattaatgcaaaatttcttgaaattggccttcagtaat
acctctaataatattgaaacctgcgggatattggctggaagattagaaagaaacagatta
ctagtaacccatttcttgataccaaagcaaactggttctcccgactcttgcgtcacacac
aatgaagaggacatctttgattttcaagatcaacataatttgattactcttggatggatc
catacacatccaacacaaacggcgtttctatccagcgtagatctgcatactcactgtgct
taccaacttatgatggctgaagcaattgcaatagtttgtgctccaaaatatgatgagacc
ggctttttccacttgacaccagattatggtttgaactatatagctaattgcagagaaact
ggttttcatccgcacccttctgaaccaccattattcactactgcaaaacattttatattg
gaccctctggcacctatagaagctgttgatttacgaagaaaatga

DBGET integrated database retrieval system