KEGG   Nasonia vitripennis (jewel wasp): 100120321Help
Entry
100120321         CDS       T01081                                 

Definition
DNA excision repair protein ERCC-1-like
Orthology
K10849  
DNA excision repair protein ERCC-1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Nucleotide excision repair
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    100120321
   03460 Fanconi anemia pathway
    100120321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 261 aa AA seqDB search
MSSDKEISKDAPQEKKAKVDDANSFGAAFSNLKKSEFFKDELPESTKGESSKNKNTNLNP
LLINPKQRGNPLLKHITSVPYEYSEIIPDYVVGKTSCILFLSLRYHQLNPDYIHERLKTL
GSSYNLRVLLVQVDVAEPHHSLKHLTRICILADLTLMLAWSAEEAGKIIETYKAYENKPP
DMIMERSDTAPHQKLINALTTVRSVNKTDAMTLLSTFGTFKDIIEAPSASLALCPGFGPQ
KAQRLNKTLHETFLRQKNTKD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgataaagaaatttctaaagatgcaccgcaggagaagaaagctaaagtagat
gatgcaaattcatttggggctgcttttagtaaccttaagaaatctgagttcttcaaagat
gaacttccagaaagtacaaaaggagaatcatccaaaaataaaaatacgaatttgaatcca
cttttgataaacccaaaacaaagaggtaatccattgttgaaacatatcactagcgtacct
tatgagtattctgaaattattccagactatgttgtgggtaaaacctcttgtattttattt
ctgtctcttcgatatcatcaattaaatccagattacattcatgaacgtctaaagacactg
ggctcatcttacaatcttcgagtattattagttcaggttgatgtagctgaaccacatcat
tcactgaagcatttgacaagaatttgtatacttgctgatctaacactaatgctggcatgg
agtgcagaagaagcaggaaagattatcgaaacctacaaagcatacgaaaacaagcctcct
gatatgataatggaacgtagtgatacagctccacatcaaaaactaataaatgcactgact
actgtcagatctgtaaataaaactgatgctatgactcttctgtcaacatttggaactttt
aaagatataatagaagcaccctctgcttcattggctttatgccctggatttggtccgcaa
aaggcacaacggctgaataaaactttgcatgaaacatttttacggcaaaaaaataccaag
gattaa

DBGET integrated database retrieval system