KEGG   Nasonia vitripennis (jewel wasp): 100120391Help
Entry
100120391         CDS       T01081                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 238 aa AA seqDB search
MVAGTATGMPGSIYHERQVKELCALHALNNLFQERKFSKQELDQICYNLSPDVWINPHKS
LLGLGNYDINVIMAALQIRGCEAVWFDKRRDPDCLCLDNIEGFILNVPHEYKFGFVLLPV
KRRHWIALKKINGAFYNLDSKLDSPQLIGKDSDLLTYLKEQMENKEKELFLVVSQEVESR
QGWLTESSEKKDSNDKSEESIQRIKETVLDNANTDLNLNNSKENINGNGNILNNQSTR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcaggtacagcaactggtatgcctggttctatttaccatgagcggcaggtaaaa
gagctatgtgcattacacgctcttaacaatttatttcaagagcgcaaatttagtaagcaa
gaactggatcaaatatgctataatttgagtcctgatgtctggataaatccacataaatca
cttctcggacttggcaactatgacataaatgtcataatggcagctttacaaataagaggc
tgtgaggctgtttggtttgataagcgcagggatccagactgtttatgccttgataatatc
gaaggttttatcttgaatgtcccacatgagtataaatttggttttgtgctgctaccagtg
aaaagacgacattggattgcattgaaaaaaattaacggtgccttttacaatctggactcc
aagctggattctcctcagttaattggaaaagacagtgatttattgacttacttaaaagaa
caaatggaaaacaaagaaaaagaactgtttttagttgtgtcgcaagaagtagaaagcaga
caagggtggttgactgaatctagtgagaagaaagactcaaatgacaaaagtgaagaatct
atacaacgtattaaagaaactgttttagataatgcaaatacagatttgaatttgaataat
tccaaagaaaacattaatggaaatggtaacattctcaacaaccaaagtactagatag

DBGET integrated database retrieval system