KEGG   Nasonia vitripennis (jewel wasp): 100120448Help
Entry
100120448         CDS       T01081                                 

Definition
(RefSeq) probable elongator complex protein 3
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100120448
Transfer RNA biogenesis [BR:nvi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100120448
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100120448
   HAT complexes
    Elongator complex
     100120448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 547 aa AA seqDB search
MGKKRREFTQSKEERMMMTIGEIIRELLNAHEANKDVDLNKLKTQISSKYGLSSSPKLVD
IIAAVPYDVKHILLPKLKAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMSLPE
DYRDYFIRNLHDALSGHVSNNVAEAVKYSERSRTKCIGITIETRPDYCLKKHLSDMLNYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLSKDAGFKVIAHMMPDLPNVDIERDIE
QFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPSVLVDLIARVLALIPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALERMKDLGVTCRDVRTREVGIQEIHNKVQPNE
VELIRRDYVANNGWETFLSYEDPLQDILVGLLRLRKCSNDTFRAELKEKCSIVRELHVYG
SVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSKKIAVISGVGTRNYYRKMGYELDG
PYMSKSL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagcgaagagaatttacacaaagtaaggaggaacgtatgatgatgacaatt
ggagagatcattcgagaacttttaaatgcacatgaagccaataaggatgtggatttaaac
aaactaaaaacacagatttcatccaaatatggtctttcatcatcacctaaattagttgac
atcattgctgctgttccatatgatgtcaaacacattcttttgccaaaacttaaggcaaaa
cccattagaacagcgagtggtatcgcagttgtagccgtcatgtgtaagccacatagatgt
ccacacattaatatgacaggaaatatttgtgtttattgtcctggtggtccagattcagat
tttgagtactctacacaatcttatacaggatatgaacctacatcaatgagggcaatacgg
gctcgttatgatccttttttacagacaagacatagagtcgaacagttaaaacagttagga
cacagtgtagataaagtagaatttatagttatgggaggaacatttatgtctttaccagaa
gattatagggattattttataagaaatttgcatgatgctctatctggacatgtaagcaat
aacgtagcggaagctgttaagtattcagaaagaagtagaactaaatgtataggtattact
attgaaacacgaccagattactgtttgaaaaagcacttatcagacatgttaaattatgga
tgtactcgattggaaattggagttcagtctgtatatgaagatgtagctcgagatactaat
aggggtcacacagtacgagcagtttgtgaaagttttcaactatctaaagatgctgggttc
aaagttattgcacatatgatgcctgatctccctaatgtggatattgaaagagacattgag
caattcattgaatttttcgaaaatccagcttttagagctgatggtttaaaaatatatcct
actttagttattagaggcacaggattatatgaattgtggaaaacaggaagatataaaagc
tatccaccaagtgtacttgttgatttaatagcacgagtcttagcccttatccccccatgg
acgcgcgtctatcgtgttcaaagagatattcctatgcctttagtaagttctggtgtagag
catggaaatcttcgtgaattagctcttgaaagaatgaaagatttgggagtcacctgtagg
gatgtcagaacaagagaagttggaattcaagagatacacaataaagttcaacctaatgaa
gttgaattaattcgtcgggattatgtggcaaacaatggatgggaaacgtttttgtcttac
gaagatcctttacaagatatattagttggtttattgagacttagaaaatgttctaatgac
actttcagagctgaattaaaggaaaagtgttctattgtaagagaacttcatgtatatgga
agtgttgtgccagtaaacgcgagagatcctacgaaattccaacatcaaggttttggtatg
ctattgatggaagaagcagaaagaatcgcaagggaagagcatggatctaaaaaaattgct
gttatttcaggtgtaggaactaggaattactaccggaaaatgggctatgaattagacgga
ccttatatgtcaaagtctctttaa

DBGET integrated database retrieval system