KEGG   Nasonia vitripennis (jewel wasp): 100120449Help
Entry
100120449         CDS       T01081                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100120449
Peptidases [BR:nvi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100120449
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100120449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
Position
2
AA seq 359 aa AA seqDB search
MRASQLFLATMVPVIIADFWYNGVFLLWTMKVSICIYIFLFGLLPLVFRYSYQVQKKILF
LNFVHWPVGVDITKPETVGMKGTRNFYLTTDENVKIGAWQILPQSLMNQTIPDNEEAYEA
LLKNASRPVFLYMHGNSGNRASSHRVELYQLFQRLDFHVICFDYRSYGDSDNVDLSEMGV
VHDSKFVLEWLIKIVNNSAPIFVWGHSLGTGVSSHVLAILASNGINPAGLFLESPFNNLA
DEITEHPFAQVFKHLPWFHWIIVQPLYDNELRFESDKHIGKIQCPVMILHAEDDNVVPFS
LGEKLFIAAKALHVDDMQRIQMTRINASYGLGHKYICRYKDLPRIIENFVTQSTAGEKI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcaagtcagctattcttagctacgatggtacctgtcatcatagctgatttttgg
tataatggagtatttctgctatggaccatgaaagtatcaatctgcatttacattttccta
tttggattactccctcttgtttttcgatactcatatcaagtacaaaaaaagatacttttt
ctgaattttgtacactggcctgtaggagttgatattacaaagcctgaaactgtgggaatg
aaaggaacaagaaatttttatcttactactgatgaaaatgttaaaattggtgcttggcaa
atattgccacagtctttgatgaaccagaccattccagacaatgaagaagcttacgaagca
ttattgaaaaatgccagcaggccagtatttttgtatatgcatgggaatagtggcaacaga
gcgagcagtcatagggtggagctttatcaattatttcaaagacttgattttcatgtgatc
tgttttgattaccgaagttatggagatagtgataatgttgacttatctgaaatgggagtt
gttcatgacagcaagtttgtacttgaatggctgattaaaattgtaaataattcagctcca
atttttgtctggggtcattcgcttggtactggagtttcatctcacgttcttgctatactt
gcgagtaatggaataaacccagcagggctatttttagaatctccatttaacaatcttgct
gatgaaataacagagcatccatttgctcaggtattcaaacacttaccatggtttcattgg
atcattgtgcagcctctttatgacaatgaactgaggtttgaatctgacaagcatattggg
aaaattcaatgtcctgttatgattttacatgctgaagatgataatgttgttccattttca
ttaggagaaaagctttttattgctgcgaaagcgttacatgtagatgatatgcaacgaata
caaatgaccagaataaacgcctcgtatggacttggacataaatacatatgccggtacaaa
gatttaccgagaataattgaaaattttgtaacacaatctacagctggagaaaagatatga

DBGET integrated database retrieval system