KEGG   Nasonia vitripennis (jewel wasp): 100120450Help
Entry
100120450         CDS       T01081                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100120450
   04150 mTOR signaling pathway
    100120450
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100120450
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100120450
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100120450
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100120450
  Mitophagy factors
   Other mitophagy factors
    100120450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 519 aa AA seqDB search
MTDKLANNQAQPIVKIGHYTLGATLGVGTFGKVKIGEHVLTKHKVAVKILNRQKIKSLDV
VGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKHGKLKEYEAR
RFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNLHVKIADFGLSNMMMDGEFLRTSCGSP
NYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGVFPIPEYL
NKSVVNLLCHMLQVDPMKRATIEDIKKHEWFQKELPTYLFPSPVEQDSSIIDVDAVNEVC
EKFNVKEAEVHAALLNGDPHDQLAIAYHLIIDNKRIADEAAKAEIKDFYVASSPPPVAFS
PSNEASGSGSPLRPHPERIAPLRDRQGSLSTTPTQMQGNRGTPVKRAKWHLGIRSQSKPN
DIMNEVYRAMKALGFEWKIINAYSVRVRHKNPVTDRYSKMSLQLYQVDYKSYLLDFKSLS
SEESEDITRDITLPPPQATGHHTMEFFEMCAALITQLAR
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaaactggcgaataatcaggcacagcccattgtcaagataggacattacaca
ttgggagccactctaggtgttggaacgtttggaaaagtgaaaattggtgaacatgtgctg
accaagcacaaggtggctgtcaaaatcttgaatcgacaaaagatcaagagcctcgacgtt
gttggcaagattcgcagggagattcaaaatctcaagctctttcggcatccgcacatcatc
aaattgtaccaagtcataagcactccaacggatatattcatgattatggaatacgtctct
ggcggagaactgtttgactatattgtcaaacatggcaagctcaaggagtacgaagctcga
aggttctttcaacagataatttctggcgtggactactgccatagacacatgattgttcac
cgcgacttgaagcctgaaaatttgctgctggatcacaatctccatgtaaaaattgcagat
tttggcctatccaacatgatgatggatggagagtttctgaggacttcgtgtggatcgcca
aattatgctgcgcccgaagtaatctctggaaagctgtacgcaggacccgaggtggacatt
tggtcttgcggagtcattttatatgccttgctttgtggaacgctgcccttcgacgatgag
catgtaccaaccttgtttcgaaagatcaaatcgggagtctttccaattcctgaatatctc
aataagagtgtggtgaatctcttgtgccacatgctccaagttgatccaatgaagagggcc
accatagaagatatcaagaagcacgaatggtttcaaaaagaactgccaacgtacttgttt
ccttctcctgtagagcaagattcttcgataatcgatgtagatgccgtgaacgaagtctgt
gaaaaattcaacgtcaaggaagccgaagttcatgccgccttgctcaatggcgatccgcat
gatcaattagccattgcttaccatttaattatagacaataagcgaatcgccgatgaagca
gcaaaagcagagataaaagatttttatgtagcttccagtccgccaccggttgctttcagt
cctagcaatgaggccagtggtagtggaagtccgttaaggccgcatcctgaaagaatcgcc
ccactccgagacaggcagggctctctgagcactactcctacccaaatgcaaggtaatcga
ggcacgcctgttaaaagggccaagtggcatttgggaatcaggtctcaatccaagccaaat
gatatcatgaatgaagtctatcgtgccatgaaagcgcttggattcgaatggaaaataatc
aacgcgtacagcgttagggtgaggcataaaaatccagtgactgataggtatagcaagatg
tcgctgcagctttatcaagtagattacaagagctaccttctagatttcaaatcgttatcg
agcgaagagtccgaggacattactagagatatcactctacctccaccgcaagcaacaggc
catcataccatggaattttttgaaatgtgcgctgcgttaataacgcaattggcgcgataa

DBGET integrated database retrieval system