KEGG   Nasonia vitripennis (jewel wasp): 100120600Help
Entry
100120600         CDS       T01081                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100120600
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100120600
Glycosyltransferases [BR:nvi01003]
 Glycan extension
  Type 3 chain
   100120600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 358 aa AA seqDB search
MLPSTKSARVNRRLVLTLAAGVVCGFLSACLFITATRDMPHMLYWFPTGSYRDPHHYSQL
EREVGPDVEVSFHGNDEDFHKGEDRVAQEMAKKVRVLCWVMTGPKNHQTKARHVKATWGK
RCNILLFMSSVEDPSLPTVVLPVKEGRDNLWAKTKEAFKYTYENYKDKADWFLKADDDTY
VIVENLRYMLSPHSPSSPLYFGCRFKPFVKQGYMSGGAGYVLSRESLRKFVEEGLPNSTH
CRQDAGGAEDVEMGKCLERVGVRAMDTRDLHGRGRFFPFVPEHHLIPNHVDKDFWYWKYI
YYEAKDGLDCCSDSAVSFHYVSPNMMYVLEYLIYHLRPYGINHAIEELPTGSDRPARR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttgccatcaaccaaaagtgcccgagtcaaccgtcgattagttttgacgttagctgcc
ggtgtcgtttgtggattcctatcagcatgtcttttcatcacagctaccagggacatgccc
catatgttatactggtttcccactggttcttacagagaccctcatcattattcgcaactg
gagcgagaggttggaccagatgtcgaggtatcgtttcacggtaacgacgaagactttcat
aagggtgaagacagggtagcgcaggaaatggcgaaaaaggtgcgggtcctgtgctgggtc
atgactggcccgaaaaatcaccagaccaaagctaggcacgtaaaagcaacatggggcaag
cgttgtaacattctactatttatgagttccgtagaagatcctagcctaccaactgttgta
ctgccagttaaggaaggtagggataacttgtgggcaaagaccaaagaagcatttaaatat
acgtatgaaaactacaaagacaaagcggactggtttctcaaagccgacgatgacacgtac
gtgatagtagaaaacttacgctacatgctatctccgcactcgccgtcctcgcctctgtac
tttggctgccgtttcaagcctttcgtaaagcaaggctacatgagcggtggtgcgggctac
gtcctgagtcgcgaaagtctacgtaagttcgtcgaggagggcctgccaaacagtacgcac
tgtcgacaagatgccggtggcgccgaggatgtcgagatgggcaagtgtctcgagcgcgta
ggtgttcgcgcgatggacacccgtgatctccatggacgcgggcgattcttcccattcgta
ccggagcaccatctcatacccaatcatgttgataaagacttctggtactggaagtacatc
tattacgaggcaaaggatggccttgattgctgctcggacagcgccgtgtccttccactac
gttagtccgaacatgatgtacgtgctggaatatttgatttatcacttgagaccttacgga
attaatcacgcgatcgaggagctgcctacgggcagcgatcggcctgctcgtcgatga

DBGET integrated database retrieval system