KEGG   Nasonia vitripennis (jewel wasp): 100120622Help
Entry
100120622         CDS       T01081                                 

Definition
uncharacterized LOC100120622
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 870 aa AA seqDB search
MEEHSFHEKEGHNDNSIQHRLSESRPKFKPVLVKKLLADESDDDTDDPPSNSDHSDEEFD
DFEGGFQPLSEETADDSKSKPSLVAKTDVQLDVVIKEEAVAATTSVTSTVEKVELPRSDG
HVRSKEAAESKSVLNAYLKDSLRITEYVVKKSEEEKLLLDKAPAGANCKSDLESVTLQSQ
WQPKAATILDKRKSSSMKDPNDLNAKPKYSPDIKRHSNSSVVNQESLEHNRFSSSSLNKQ
HSNEISEERSSMASKADQIGSTKCSGSQSTANASMAAMDTPMKQPQGSARPNPCHSHRNI
FQTPQSKIGSEFAKNSIQTPATIFSHWSQQHMAQTPMQSQISSSRESRESREPMQTPATS
IAQSQSSRHENPRYFTGESKSVRRPLAETMYSAPTHGPQLPRLQEAPNETNHSPPISRES
GSIVKPDNFQEKKPVYSSTHVTHETKENRNPNPHEIVKNEGHAKLAASESRHSIQSHIES
KPKMEYHSNAYSNMQPPRTSDNYQVKESQNAHPPIPSQAEQMQTIQCSIPQQLNSWNSRQ
NKIITVKDRQYLVLGVLGQGMSCEVVRAQDLSSSELRAIKCVNLSKMDKDSAQGCLQEIC
MLDRLKAPCIVHMYNFEIKQPWVHVVMEIGDTDLSRLLKSMLQEKKQIPLTMILYYWTEM
LTAVKHIHENGVIHSDLKPANFLLVRGRLKLIDFGIASNINSDMTSVVKNCPIGTLNYIS
PEALMDVNAGSTDSPNHSNKFKISYKSDVWSLGCILYGLVYGVTPFNHIRQQWAKISAIT
DPKHKINFPLKTGSEPVPLILVDAMRKCLQRDAKARPTVAELLEIPYLQSNISAPIVPSI
PPNILIKIKHALSDEEWKQLTEILDTRGKP
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacattcattccacgagaaagaaggccataatgacaactctattcagcatcga
ctatctgaatcaagaccaaaatttaagcctgtgctggtaaagaagttgttagccgatgag
agtgacgatgacactgatgatccaccttcaaattcagatcattcagatgaggagtttgat
gattttgaaggtggttttcagccgctttctgaggaaactgccgacgattccaaaagcaaa
cccagtttagttgctaaaactgatgttcaactagatgttgtaatcaaggaagaagctgtg
gctgctactactagtgtcacaagtactgttgaaaaggttgaattgccaagaagtgatggc
catgttagaagcaaggaagctgctgagtcaaagtcagttttgaatgcttatttgaaagat
tctttgagaattacagagtatgtagtgaaaaagagtgaagaagaaaaattattgttagac
aaagctcctgctggggcaaattgtaaaagcgatctagaaagtgtcacgctgcaatctcaa
tggcaaccaaaagcagctacaattctagataagagaaaatcttcctctatgaaagatcca
aatgatttgaatgccaagcctaaatattctcctgatataaaacgtcattctaatagctct
gttgtaaatcaagagagtcttgagcataatagattttcctcttcaagtctaaataaacag
catagtaatgaaataagtgaagaaagatcttcaatggcctcaaaggcagatcaaataggt
agtacgaagtgctctggttctcagtcaacagcgaatgcatcaatggcagcaatggatact
ccaatgaagcaaccacaaggatctgccagaccaaatccttgtcactcgcatagaaatatt
ttccaaactccccagagcaagatagggagtgaatttgctaagaattctatacaaacacct
gctacaatattttcacattggtcccaacaacacatggctcagactccaatgcaaagtcaa
atttcttcatcaagagagtcaagagaatcaagggaacctatgcaaactccagcaacaagc
attgctcagtcacaaagttctagacatgaaaatccaaggtattttactggtgaaagtaaa
agtgttcgcagaccgctagcagagaccatgtattcagccccaacacatgggccacaactt
ccaaggttacaggaagcaccaaatgaaactaatcatagccctccaatttcaagagaaagt
ggaagtatagttaaacctgataattttcaagaaaagaaacctgtatatagttctactcac
gtcactcatgaaaccaaggaaaatcgaaatcctaatcctcatgaaattgttaaaaacgaa
ggtcatgcaaaattggcagcatctgaatcaagacattctattcagtcccatattgaaagc
aagccaaagatggaatatcacagtaatgcttatagcaatatgcaacccccaagaacatca
gataattatcaagtcaaagaaagtcagaatgcacaccccccaatcccaagtcaagcagag
caaatgcaaacgattcagtgctcaattcctcaacagcttaattcatggaactcgagacaa
aataaaatcattactgtcaaagatcgccagtatttagttttaggtgttcttggccagggg
atgagctgtgaagttgtgagggcacaagacttatccagttcagaactgagagctattaag
tgtgttaatctgagtaagatggataaggattcagctcaagggtgtttgcaggaaatttgt
atgcttgacagattgaaagctccttgcatcgttcacatgtataattttgagataaaacaa
ccgtgggttcatgttgttatggaaataggtgacacagacttgagtcgtttactgaagtct
atgttgcaagaaaagaaacaaatacctctgacaatgattctttactattggacagaaatg
ttgactgcagtaaagcacatccacgaaaatggagtcattcattccgatctaaaacctgcg
aatttcttattagtacgaggtagattaaaactcatagacttcggtatcgcatcaaatatc
aattcggatatgacatctgttgttaaaaactgtccgatcggcactttaaactatatcagt
cccgaagcactgatggatgttaatgcaggaagcaccgattctccgaatcatagtaataaa
ttcaagataagttacaaatccgatgtttggtcattgggttgtattttatatggactagtc
tacggcgtaaccccgttcaatcacatccgtcaacagtgggctaaaatcagtgctataact
gatcccaagcataagataaatttccctctgaagacgggatccgaaccagtaccattaatt
ttggtcgacgcaatgcgcaagtgtctgcaacgcgacgctaaagcaagacctacggtagct
gaactcctagaaattccatacttacagagcaacataagtgctccaatagtaccaagtata
ccaccgaatatcctgattaagatcaagcatgctctttctgacgaagagtggaaacaactt
actgagatacttgatactagagggaaaccgtga

DBGET integrated database retrieval system