KEGG   Nasonia vitripennis (jewel wasp): 100120735Help
Entry
100120735         CDS       T01081                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100120735
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100120735
  Amino acid metabolism
   00310 Lysine degradation
    100120735
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100120735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 483 aa AA seqDB search
MVGILSNSSRVAPRALRRLTLLQSKVVRTLYQGGPTSCVRAQRVLDRHVQNSQTKPHVIQ
SWSIQSRYIQSTSSLWEMKDVVVPAFADSISEGDVRWEKKEGDQVKEDDVLCEIETDKTS
VPVPSPAAGVLKNILKKDGDTVTPGTKLCQIDVGATGGAAPSKAAETPKAEAPKAPEPAK
AAPPPPPPAAAAPPPPSHAPPPPPPPPASAPPPPQAPKASMPVAAIKHAQSLEGAKVQLP
PQDYTREIIGTRTEQRVKMNRMRLRIAERLKDAQNTNAMLTTFNEIDMSALIDFRKSNQE
SFQKKYGLKLGFMSPFIAASAYALKDQPVVNAVIDGTDIVYRDYVDISVAVATPKGLVVP
VLRSVENKNFAEIEIAMAAVGDKARKGKISVEDMDGGTFTISNGGVFGSLMGTPIINPPQ
SAILGMHGVFDRPIAVKGQVVIRPMMYVALTYDHRLIDGREAVMFLRKIKDAVEDPRIIL
AGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaatactttccaactcgtcgcgggtcgccccacgcgccctgagacgtctaacc
ttgctgcaatccaaggtagtccggacgctgtatcaaggagggccaacttcttgtgttaga
gctcaaagggttctggacagacatgtccaaaacagtcagaccaaaccccatgtgatccaa
tcttggagtattcagtccagatatatacaatcaacttcgtcattatgggagatgaaagat
gtcgtggtgcctgcatttgccgacagtataagcgaaggagatgtaaggtgggaaaagaaa
gaaggagaccaagtgaaggaggatgatgttttgtgtgaaatcgaaactgacaaaacatcg
gttcctgttccatcccctgctgctggagttctcaagaatattctcaaaaaggatggtgac
actgtaactcctggaactaaactgtgtcaaattgatgttggtgctactggtggtgcagct
ccatcaaaagcagctgaaactccaaaagctgaggcaccaaaggctcccgaaccagcaaaa
gcagcacctccaccaccaccaccagctgctgcagctccaccaccaccatctcacgctcct
ccgccaccaccgccaccaccggcatctgcaccaccgccacctcaagctcccaaggcatcc
atgcctgtagcagctatcaaacatgcacagtctctggaaggtgcaaaagtacaactgcca
ccgcaagactacacccgcgagatcatcggcacccgaactgaacagcgagtcaagatgaac
agaatgcgtcttcgcattgcagagcgtttgaaggatgctcagaacaccaatgccatgttg
acaacattcaatgaaatcgacatgagcgccctgatcgatttccgtaaatcgaatcaagaa
tccttccagaagaagtatggccttaaattaggttttatgagtccattcattgctgcttct
gcttatgctctaaaagatcagcctgttgtcaatgccgtcatcgacggtactgacatagtt
tacagagattacgtcgatattagcgtagctgtagccacaccaaaaggtctagtcgtgcct
gtactgcgaagcgtagaaaataagaactttgctgagatcgaaatagccatggctgctgtg
ggtgacaaagctaggaaaggaaaaatttcagttgaagatatggacggcggcaccttcacg
ataagcaacggtggagttttcggatcccttatgggaactccgattattaatcctcctcag
agtgccattctgggaatgcacggtgtctttgatagacctattgctgtcaaaggacaggtt
gttattcgacccatgatgtacgtggcgctcacgtacgatcatcgattaatcgatgggcgt
gaagctgtgatgttcttgagaaaaatcaaggatgcagtggaagatcctagaatcatttta
gctggtctttaa

DBGET integrated database retrieval system