KEGG   Nasonia vitripennis (jewel wasp): 100120778Help
Entry
100120778         CDS       T01081                                 

Definition
uncharacterized LOC100120778
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 178 aa AA seqDB search
MCGKLNCLPVKYSEQNTAISGTTTEEYKANLKKIYTVSTAQSFWAVFNNIPNAGDMQVRY
SYHLMRDERYPLWEEPANQNGGTWRFKCHKIDTANVWKEVVLAAIGEQFSESLDENDEIC
GITVSIRDRDDLIQIWNIDASLAPKASVIAKVHSLVPEVTFLAEFYKPHRSHHAYNRH
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaagttaaactgcctaccagtaaaatactcggagcagaatacagcaatttct
ggaacaactactgaagaatacaaggccaacttgaagaaaatttacacagtcagcactgca
cagagcttttgggctgtttttaacaacattcctaatgctggtgatatgcaggtccgctac
agttaccacctaatgcgagacgagcgataccctctttgggaagagccggctaatcagaac
ggcggtacctggcgattcaagtgccataagatcgacacggcaaacgtttggaaggaagtt
gttctggccgctataggcgagcagtttagcgaaagcttggacgaaaacgacgagatctgc
ggcatcactgtatccattcgggaccgagatgatctcattcagatttggaatattgatgcg
tcattagcaccaaaggcttctgtcatagcaaaggtgcatagcctcgttccagaggtcacg
ttccttgcagagttttacaaacctcaccgttctcatcacgcttacaatcgtcattga

DBGET integrated database retrieval system