KEGG   Nasonia vitripennis (jewel wasp): 100120866Help
Entry
100120866         CDS       T01081                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100120866
Enzymes [BR:nvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100120866
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100120866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 335 aa AA seqDB search
MEIESKNILHSGYFHPVLRQWQAPNVGITAENLMFPIFVLDEPNAVTEIQSMPGVNRYGI
NKLKGLLEPLIAKGLKSILLFGVANNLPKDEIASAADSPANPIIQALPLLRNWFPSLIIA
CDVCLCPYSSHGHCGILNDDGTIDNKPSIKRIADIAVAYAKAGAHIVAPSDMMDGRIKAI
KHGLAAAGLSNKVAVLSYSVKFASGFYGPFRDASKSAPKFGDRQCYQLPSGSNGLAARAA
ARDIEEGADMLMVKPGLAYLDIVKETKNAHPEYPMFIYQVSGEYAMLYHGAQNGAINLEA
VLKEVLVCMRRAGADCIITYFTPLILDMLRPKSKF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgaatcgaagaacatattgcacagtggatacttccatcccgttttgcgacaa
tggcaggcaccgaacgtgggcatcactgcggagaatctcatgtttcccatcttcgttcta
gacgagcctaacgcagtcacggagattcagagtatgccaggagtcaacagatatggtatc
aataagttgaaaggcttgttagaaccactaattgcaaaagggctcaagtctattttactt
ttcggagttgctaacaatttgccaaaggatgaaattgcaagtgcagccgatagtcctgca
aatccgatcattcaagcactgccactgttaagaaactggtttccaagcctaattattgcc
tgtgatgtttgtctgtgcccttactccagtcatggacattgtggaatacttaatgatgat
ggaaccattgataataagccaagtatcaaacgcatagcagatattgctgtggcatatgcc
aaggctggagctcacattgttgcaccatccgacatgatggatggtagaataaaggctatt
aaacacggtcttgctgctgctggtttatcaaataaagtagctgttctgtcttattcagtg
aaatttgcctctggcttttatggaccatttagggatgcatcaaaatcagcacccaaattt
ggtgataggcagtgttatcagctgccttcgggtagcaatggcttagcagccagagcagct
gcaagagacatcgaagaaggtgccgacatgctgatggtgaagcccggtctagcttactta
gacattgtcaaagagacaaaaaacgcacatcctgaatatccgatgttcatctaccaggta
tccggagaatacgccatgctttaccatggcgcgcaaaacggcgctatcaatttggaggct
gtgctcaaagaggttcttgtctgtatgagaagagcaggcgcggactgtattattacatat
tttacgccactaattttggacatgctgcgtccgaaaagcaaattctaa

DBGET integrated database retrieval system