KEGG   Nasonia vitripennis (jewel wasp): 100120866Help
Entry
100120866         CDS       T01081                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 3
  KO
K09490  
heat shock 70kDa protein 5
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Protein export
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    100120866
   04141 Protein processing in endoplasmic reticulum
    100120866
Chaperones and folding catalysts [BR:nvi03110]
 Heat shock proteins
  HSP70 / DNAK
   100120866
Membrane trafficking [BR:nvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    100120866
Transporters [BR:nvi02000]
 Other Transporters
  Pores ion channels [TC:1]
   100120866
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100120866
  Exosomal proteins of other body fluids (saliva and urine)
   100120866
  Exosomal proteins of colorectal cancer cells
   100120866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 964 aa AA seqDB search
MEIESKNILHSGYFHPVLRQWQAPNVGITAENLMFPIFVLDEPNAVTEIQSMPGVNRYGI
NKLKGLLEPLIAKGLKSILLFGVANNLPKDEIASAADSPANPIIQALPLLRNWFPSLIIA
CDVCLCPYSSHGHCGILNDDGTIDNKPSIKRIADIAVAYAKAGAHIVAPSDMMDGRIKAI
KHGLAAAGLSNKVAVLSYSVKFASGFYGPFRDASKSAPKFGDRQCYQLPSGSNGLAARAA
ARDIEEGADMLMVKPGLAYLDIVKETKNAHPEYPMFIYQVSGEYAMLYHGAQNGAINLEA
VLKEVLVCMRRAGADWLVAAIAASKEEKKDKDDIGTVIGIDLGTTYSCVGVYKNGRVEII
ANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWTDATVQHDVK
FFPFKVIEKNSKPHIKVSTSQGDKIFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPA
YFNDAQRQATKDAGIISGLQVMRIINEPTAAAIAYGLDKKDGEKNVLVFDLGGGTFDVSL
LTIDNGVFEVVATNGDTHLGGEDFDQRVMDHFIKLYKKKKGKDIRKDNRAVQKLRREVEK
AKRALSASHQVRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDADMSKK
DVDEIVLVGGSTRIPKVQQLVKEFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAI
VLLDVNPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTASDNQHTVTIQVYEGERPMTK
DNHLLGKFDLTGIPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGNREKIVITNDQNRLT
PDDIERMIKDAEKFADEDKKLKERVEARNELESYAYSLKNQLQDKEKLGSKVSDSDKAKM
EEAIDEKIKWLEENQDTDPEEYKKQKKELSDIVQPIISKLYQGAGGGVPPTGGEESDDDL
KDEL
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgaatcgaagaacatattgcacagtggatacttccatcccgttttgcgacaa
tggcaggcaccgaacgtgggcatcactgcggagaatctcatgtttcccatcttcgttcta
gacgagcctaacgcagtcacggagattcagagtatgccaggagtcaacagatatggtatc
aataagttgaaaggcttgttagaaccactaattgcaaaagggctcaagtctattttactt
ttcggagttgctaacaatttgccaaaggatgaaattgcaagtgcagccgatagtcctgca
aatccgatcattcaagcactgccactgttaagaaactggtttccaagcctaattattgcc
tgtgatgtttgtctgtgcccttactccagtcatggacattgtggaatacttaatgatgat
ggaaccattgataataagccaagtatcaaacgcatagcagatattgctgtggcatatgcc
aaggctggagctcacattgttgcaccatccgacatgatggatggtagaataaaggctatt
aaacacggtcttgctgctgctggtttatcaaataaagtagctgttctgtcttattcagtg
aaatttgcctctggcttttatggaccatttagggatgcatcaaaatcagcacccaaattt
ggtgataggcagtgttatcagctgccttcgggtagcaatggcttagcagccagagcagct
gcaagagacatcgaagaaggtgccgacatgctgatggtgaagcccggtctagcttactta
gacattgtcaaagagacaaaaaacgcacatcctgaatatccgatgttcatctaccaggta
tccggagaatacgccatgctttaccatggcgcgcaaaacggcgctatcaatttggaggct
gtgctcaaagaggttcttgtctgtatgagaagagcaggcgcggactggctagtcgcagcc
attgcggcttccaaggaggaaaagaaggacaaggacgatatcggaaccgttatcggtatc
gacttgggaaccacttactcttgtgtgggtgtgtacaagaatggtcgcgtggagatcatc
gcaaacgaccagggtaaccgtatcaccccatcatacgttgccttcacagctgacggcgag
cgtctcattggagatgctgccaagaaccagctgaccaccaacccggagaacaccgtgttc
gacgccaagcgtctcattggtcgcgaatggaccgacgctaccgttcagcacgatgtcaag
ttcttcccgttcaaagtcatcgagaagaacagcaagccccatatcaaggtctccaccagc
cagggcgacaaaatcttcgctcctgaggaaatctctgctatggttcttggaaagatgaag
gaaaccgcggaggcttacctcggtaagaaggtcacccacgccgtcgtcaccgtccctgcc
tacttcaacgacgctcagcggcaagccaccaaggatgccggaatcatctccggtctccag
gtgatgaggatcatcaacgagcccaccgccgccgccatcgcttacggtcttgacaagaag
gacggagagaagaacgttctcgtcttcgacttgggtggtggtacctttgatgtcagtctt
ctgaccatcgacaacggagtcttcgaggtcgttgccaccaacggtgacactcacttggga
ggtgaggactttgaccagcgtgtcatggatcacttcatcaagctgtacaagaagaagaag
ggcaaggacatccgcaaagacaacagggccgttcagaaacttcgtcgtgaggtcgagaag
gcgaagagagcactcagtgccagccatcaggtgaggatcgaaatcgaatccttcttcgag
ggagaagacttctccgagacgctgacccgtgccaagttcgaagagctgaacatggatctc
ttcagaagcaccatgaagcccgtgcaaaaggtccttgaagacgctgacatgagcaagaag
gacgtcgacgagatcgtgctcgtcggaggttccactcgtattcccaaagttcagcaactc
gttaaggagttcttcggtggcaaggagccatcccgaggtatcaaccctgacgaggctgtc
gcttacggtgccgccgttcaggccggagtcctctctggtgaacaagacactgatgccatc
gttcttcttgacgtcaaccctctcaccatgggtattgaaaccgttggtggagtcatgacc
aagctcatccccagaaacaccgtcatccccaccaagaagtctcagatcttctccactgcc
tctgacaaccagcacaccgtcaccatccaggtctacgagggtgagcgcccgatgaccaag
gataaccatcttcttggaaaattcgacctcaccggaatcccaccggcaccacgtggcgtc
ccccagatcgaagtcaccttcgagattgacgccaacggtatccttcaagtgtccgccgag
gacaagggaactggaaaccgggaaaagattgtcatcaccaacgaccagaacagactgacg
cctgatgatatcgagaggatgatcaaagacgctgagaagttcgccgacgaagacaaaaaa
ctcaaggagcgcgtcgaggcgcgcaacgagctcgaatcctacgcctactcgctgaagaac
cagctgcaggacaaggaaaagcttggctcgaaggtcagcgattctgacaaggctaagatg
gaggaggccattgacgagaagatcaagtggctcgaggagaaccaggacaccgaccccgag
gaatacaagaagcagaagaaagaactcagcgacattgttcagcctatcatctcgaaactg
taccaaggcgccggcggcggcgtaccacccactggtggcgaggagtccgatgacgatctt
aaggacgaactataa

DBGET integrated database retrieval system