KEGG   Nasonia vitripennis (jewel wasp): 100120952Help
Entry
100120952         CDS       T01081                                 

Definition
dual specificity mitogen-activated protein kinase kinase 3-like
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
5
AA seq 338 aa AA seqDB search
MAFNNRRKGVGLKIQLSEEAPPPVTPPRNLDKRTTITIGDKTFEVDADDLEMLCTLGRGA
YGVVDKMKHKQSDTIMAVKRITATVNTQEQKRLLMDLDISMRCSDCPYTVQFYGALFREG
DVWICMEVMDMSLDKFYTKVYKHNRSIPEEILGKIAFAVVSALHYLYSQLRVIHRDVKPS
NILINRKGEVKICDFGISGYLVDSVAKTIDAGCKPYMAPERIDPTGNPSHYDIRSDVWSL
GISLLELATGKFPYESWGTPFEQLKQVVKDEAPKLPPNRFTPEFEEFINKCLMKNYTARP
NYNQLLELSFIKEHATKDTNVAGFVEEVLDLPDAEQSA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaacaatcgaaggaaaggagtgggtctgaaaatacaactctccgaagaagct
cctcccccagttactccaccaagaaatctagataaaaggacaacgattacaataggagat
aagacttttgaggtggatgctgatgatttagaaatgttatgcactcttggacgcggagcc
tatggagttgttgacaaaatgaaacacaaacaaagtgataccatcatggcagttaagaga
attacagccacagtcaatacccaagaacagaagcgattgctgatggacttggatatttca
atgcgatgttcagattgcccttatacagtgcaattttatggagcacttttcagagaaggc
gatgtttggatttgtatggaggttatggatatgagtcttgataaattttatacaaaggta
tacaaacacaaccgttcaatacctgaagaaattctaggaaaaatagcctttgcagtagta
agtgcactgcattatttgtattcgcaactaagagttattcatagagatgttaagcctagt
aatatattaattaatcgaaaaggagaggtaaagatctgtgattttggaatatctggttat
ttagttgattctgttgctaaaactatagatgctggttgtaaaccatacatggcgccagaa
aggatagaccctacaggtaatccttcgcattacgatataaggtcagatgtctggtcttta
ggtatttctctactcgaacttgcaacaggaaagtttccttatgaatcctggggcacacca
tttgaacagttgaaacaagttgtaaaagatgaagccccaaagttacctcctaacaggttc
acacctgagtttgaagaatttattaataagtgcttaatgaaaaattacacggcgcggcct
aattataatcaattgctcgaacttagttttataaaagagcatgcgacgaaagatacaaat
gtagcaggttttgttgaagaagttttagatttaccagatgcagagcaatctgcgtag

DBGET integrated database retrieval system