KEGG   Nasonia vitripennis (jewel wasp): 100121060Help
Entry
100121060         CDS       T01081                                 

Definition
dual specificity mitogen-activated protein kinase kinase 7-like
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100121060
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100121060
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100121060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 776 aa AA seqDB search
MSSTLENQILNLQERLRAENQLRDKDKQQQQQSSEMQQQQPPNMPSPCLSPAPARPRQLG
DMGTPTRPRRQLDLPVSHMMPFKRHDGEVESKMQEIMKMNGILNINGQKYHTEMKDLEHL
GELGNGTCGHVVKMRHKPSGVVIAVKQMRRSGNTDENKRIIMDLDVVLKSHDCPYIVQCL
GCFITESDVWICMELMVTCLDKLLKRSRQAIPEDFLGKVTVATVKALSYLKEKHGVIHRD
VKPSNILLDETGGVKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRA
DVWSLGITLVELATGVFPYRDCKTDFEVLSRVVQDDPPSLPSDALFSKEFQNFVSCCLTK
NYKQRPKYNKLMEHPFIRKYELQQETYSSTPSSGCQWFYRIMRQLEPSFRVPTSSITSST
ISTSTSQRPSGHVSLKQTAHLRSQSSVNSHDVAAYLRNNTSSTKEPTSLNSSTSSRSNLE
NGGGYIPYSPYGFRRRDLISRPTGCNSLQRSYSPGYRQDNGYKPDERSYSPYRTGGGEAE
ATRPYSPYRERWQSSTGPRSLSPFARDYSPWRRENVDPPVIQLPTTATTTTTSSGNSTDR
YSSVVNQRLEKIVTVPQTHVQVQNIYASPMLSRKRFPSEPPPQGSHSSTSPQLLISRFAH
QLKQEPPSTVPQVQLNSKESAKKRFASYVRLRLGSDREPSPEPPPRFNRGESPLLLRRNV
GDQASPFFPRRYVSPSPPVPPPRRLSESSSVPGSPQHLYSRLNHYTPEPQRRAPPP
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcacgctggagaaccagattctgaatctgcaggagagactcagggcggagaat
cagctgagggacaaagacaaacaacaacagcagcagagcagcgagatgcagcagcagcag
cctcccaacatgcccagcccctgcctgagtcctgcacctgccagacccagacaacttggt
gacatgggaactccaacgagaccaagaaggcaacttgatctgcctgtgtcacacatgatg
ccattcaagagacacgatggggaagttgaatccaaaatgcaagagatcatgaagatgaat
ggtattctaaacatcaatggacaaaagtatcatacagagatgaaggatttggagcattta
ggagagcttggaaatgggacttgcgggcatgtagtcaagatgaggcataagcccagcggt
gttgtcatagctgttaaacagatgcgtagatcagggaacactgatgaaaataagaggata
atcatggatttggatgtagttctaaagtctcacgactgtccatacattgtgcaatgcctt
ggctgttttatcacggaatccgacgtttggatttgtatggagttgatggtcacatgctta
gacaagcttctgaagagaagcagacaagcaataccagaagattttttaggaaaagttaca
gtagcaaccgtaaaagctttgtcgtacctgaaagaaaagcatggagtaattcacagagat
gtcaaacctagcaatattctcttggatgaaacaggtggggtaaagctatgtgattttgga
atatctggtcgtttggtggacagcaaagccaagacaaggagtgctggatgtgccgcatac
atggctcctgaaaggatagatccaccagatcctacaaagcctgattatgatattagagca
gatgtttggagtctaggtattacattagtagaattagccactggagtatttccctaccga
gactgcaagactgattttgaggtactgagtagggtggtacaagacgatcctccttctctg
ccttccgatgcgctattctcgaaagaatttcaaaacttcgtcagttgttgccttacaaaa
aattataaacaacggccaaagtataacaaattgatggagcatcctttcatccgaaagtac
gagttacaacaagaaacgtactcttcaacaccgtcgtctggctgtcagtggttctataga
atcatgagacagctcgagccaagtttcagggtcccgacgtcatcgattacatcatccacc
atcagcacatcgacatctcagcggccttctggccacgtctccctcaagcaaaccgctcac
ctgcgcagtcagagcagcgtcaacagtcacgacgtggctgcatacctgcgcaacaacacc
agcagcaccaaagaaccgacatccctcaactcgtccacctcctcgcgcagcaacctcgag
aacggtggtggttacataccctacagcccctacggtttccgtcggagggacctgatctcg
aggccgactggctgcaatagtctacagcgctcgtactcgcccggataccggcaggacaac
ggctacaagcccgacgaaagatcttactcgccttacagaaccggtggcggcgaggccgaa
gcgacgaggccctactcgccctacagagaacggtggcagagttcgacgggccccaggtct
ctcagccccttcgccagggactactctccatggagaagagagaacgtcgacccaccggtg
atacagctacccacgacggctacgacaacgacgacatcgagcggcaactccaccgacagg
tactcgtcggtcgtgaatcaacgactggaaaagatcgttacagtgcctcagactcacgtg
caagtgcagaatatttatgccagtcctatgcttagtcgcaaaaggtttccatccgagcct
ccgccacagggatcgcacagttcgaccagtccacagctgctcatatcgcggttcgcacac
cagctgaagcaggaacctccttccaccgttcctcaggtacagctgaacagcaaagagtcg
gcgaaaaagcgatttgcctcgtacgtgagactcaggctgggcagcgatcgtgaaccgtcg
cccgaaccaccgccgagattcaacaggggagagtcaccgcttttgctgagaaggaacgtt
ggagatcaagcctctcctttctttccaagaaggtatgtctcaccatcgcctccagtaccg
ccaccgagacgattgtcggaaagtagctcggttccgggcagtccgcagcacctgtactcc
cggctaaaccactacacgcccgaaccccagaggcgagcgccgcctccataa

DBGET integrated database retrieval system