KEGG   Nasonia vitripennis (jewel wasp): 100121135Help
Entry
100121135         CDS       T01081                                 

Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100121135
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100121135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 100121135
NCBI-ProteinID: XP_001604721
NASONIABASE: NV16972
Position
4
AA seq 170 aa AA seqDB search
MGNESSLPMELCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKESKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTILFADKDEDGKISFEEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgagagctcgctgcccatggagctgtgctcgaactttgatgcagatgaaatt
cgaaggctgggtaaaaggttcaggaaactggatcttgacaatagtggggctttgagcatt
gacgaatttatgtctttgcctgagctgcagcaaaatccacttgtccaacgtgtaatagat
atttttgatgctgatggtaatggagaagtagattttaaggaatttattcaaggagtatct
caatttagtgtgaagggtgataaagaaagcaagcttcggttcgcgtttagaatctacgat
atggacaatgatggttttataagcaatggggaattgttccaagtgctaaagatgatggtg
ggaaacaatttaaaggatactcaattacagcagatagttgacaaaacaatactttttgct
gataaagatgaggatggaaaaattagtttcgaggaattctgttcggttgtcggcaatact
gacattcataagaagatggtggttgatgtttaa

DBGET integrated database retrieval system