KEGG   Nasonia vitripennis (jewel wasp): 100121209Help
Entry
100121209         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100121209
Peptidases [BR:nvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100121209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 888 aa AA seqDB search
MPAVSVCDPLAVAIRHNLDTAGQSKSPDDLNIGLAGSAPRILRTELDYEEADNYRSNVQD
RLKSKYMVLTLPKQEDNGKVKDTATSSKSSEKSKEPRLPEPAVTLYAPDKVNLGWDKTHN
MPVGAGMYNVGNTCYLNSTLQALFHVPALVNWLLSDAHHESKCEQNVRHHYFSDGAGECL
TCAVSKTLQFSHQKSGEAIKPFYVYNKLKLICRTMVPGQQEDAHEFLRYLLEGMEKAYLA
RHKALKLDSYSKETTPINQIFGGYIRTEVKCLQCKHVSTTFQHFQDLLLDIRKAGTLDEA
LAGYFSQEHLDNNDYKCEACKRRVPATKQFILERPPKVLCVQLKRFSVLGGKISRHIGFK
QTVDMGPYVRRQPGEQPSKLIYRLASMVTHMGPSVNCGHYTAIAQVSSGKFYSFDDSSVR
PISLNNVVSTNAYIMIFEMEPASATNGQAHGSQLVSSKNDVSALSKGNQPFSYTNGISSK
TLDSNGSSNGSKSLTSSPSGSKNGENCSTSSSKLKDEQGAPTPPPPPPLPPLPPPSQARR
NFIGPQLPPHMEKNRLQESSKSGKLVDYDGNSSDDEENNGSLKTNRDDRDVFKTVNNSSK
SVKINSNGHSCSPKGSKSPLNHNGGFHHTLSNGNDEKAEPGSSGSSSGSSSRSSSPKNGS
SNGKEQYSGPVDKSKERWTAYSKARIDSEQKVYTKASAAINNKGWQVSKDSSSPSSSTAA
NGWDEPNSNSSRSNNHSVTPSAAEMRSFNGTNRSETISHLQKSTQWAYGNTSVPSWNGGK
ARIDREVDNERRQERKRPFDNDEDELDRGRTKKVKMHHKDYRNDTKYNQFQEHHNNNIKW
RQLSNTRYRTGNCHSYNGRPRHGGGGGNYNRPPYHRHHHNKSRNNWRR
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagtcagtgtttgtgacccactggcagtggccatacgccacaacttggatact
gctggacaatcaaagtctccggatgatctgaacataggcttggcaggcagtgcccctcga
atactgcggacagagttagactacgaggaggctgataactacaggtctaatgttcaggat
cgacttaagagcaaatacatggttctcactttacccaaacaggaggacaatggcaaggtc
aaagatacggcaacctcttcgaaaagttcagaaaagagtaaagagcccaggttgccagaa
ccagcagttaccctgtatgctccggataaggtcaatcttggctgggacaaaacgcataat
atgccggttggtgctggcatgtacaatgttggaaatacgtgttacctgaacagcaccttg
caggccctctttcacgttccagcattagtaaattggctactgtccgatgcacatcacgaa
tcaaagtgcgagcagaatgtcaggcatcattacttttcagatggagctggtgagtgcctt
acatgtgcagtatctaaaactttacagtttagtcaccaaaagtctggtgaagcaatcaag
cctttttatgtttacaataaactcaaactcatttgcagaacaatggtgccgggtcagcaa
gaagatgctcatgaatttttacgttatctattagaaggcatggaaaaggcatatttagcc
agacataaagcattaaaattagacagttattcaaaggaaaccactcctattaatcaaatt
ttcggaggatacataagaactgaagtaaaatgccttcagtgtaaacacgtctcgacgacg
tttcaacattttcaagatctactattagatattcgaaaagctggtacactggacgaagca
ctagctggctacttcagtcaggagcacctcgacaacaacgactacaagtgcgaagcgtgc
aaacgacgagtaccggctacgaaacagttcatcctcgagagaccacctaaagtcctctgt
gttcagctgaaacgcttcagcgtgctaggaggcaagatttcgcggcacataggcttcaaa
caaaccgtcgacatgggcccctacgtaagacgccagccgggggagcaacccagcaaactt
atttatagactcgcttccatggtcacacacatgggcccatctgtcaattgcggacactac
actgccatagcacaagtatcgtcaggcaaattttattccttcgatgattcttccgttcgt
ccaattagtctgaataatgtggtcagtaccaatgcgtacataatgatctttgagatggag
ccggcctccgcaacgaatggccaggctcacggcagtcaactcgtgagctcgaagaacgac
gtctctgctttgtccaaaggcaatcaacccttctcctatacaaacggtatatccagcaag
actctagacagcaacggtagcagcaatggcagcaaatcgttgacttcatcacctagtggc
agtaaaaatggtgaaaattgttcgacatcctcgtctaagcttaaggatgaacaaggagcg
ccaacgccgccgccgcccccacccttacctccgttgccacctcctagccaagccagacgc
aatttcattggaccacaactaccgcctcatatggagaagaatagactacaagagtcgtca
aagagtggaaagttagtagattatgatggcaattcgagcgacgacgaggagaacaatggc
tccttaaaaacgaatcgcgacgaccgggatgtttttaaaacagtcaataactcgtctaaa
tccgtcaagataaatagtaacgggcattcgtgctcgcctaagggctcgaagtcgcccttg
aatcataacggtggtttccatcacacgttgtcaaacggtaacgatgaaaaggccgagccc
ggtagtagtggtagtagcagtggctcgtcttcgcggagttcttcgcccaagaatggctca
agcaacggcaaagaacagtacagcggtccagttgacaaatccaaggagagatggacagct
tactccaaagcgcgaatcgactccgagcagaaagtttacacaaaagcttccgctgctatt
aacaataagggatggcaagtctctaaagatagctcctcaccctcgtccagcaccgcggct
aatggctgggacgaaccaaatagcaacagcagtagatctaataaccattccgtaactccg
agtgcagccgaaatgaggagcttcaatggaactaatcgttctgaaactatatctcaccta
caaaaatctactcaatgggcctacggtaatacaagtgtccccagttggaatgggggaaaa
gcgcgtatcgatcgtgaggtcgataatgagcgtcgccaagaacgcaaacgtccctttgat
aatgatgaagatgaactcgatcgtggtcgcacgaagaaagttaagatgcaccataaagat
taccgcaatgacactaagtacaatcagttccaggagcatcataacaacaacatcaagtgg
agacaattgtcaaatacgcgctaccgtaccggcaattgccattcatataatggaagacca
cggcacggtggtggcggtggcaactataacaggccaccctaccaccgacatcatcacaac
aaatcgagaaacaattggcgcagatag

DBGET integrated database retrieval system