KEGG   Nasonia vitripennis (jewel wasp): 100121277Help
Entry
100121277         CDS       T01081                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nvi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 306 aa AA seqDB search
MAQSGALITRLVASSVTAATRAGKIIRDVMSQGELNIVDKGTNDLQTEADRSAQRCIVTS
LSQQFPGVTIIGEEEPSNCEVPSDWVVTDMDQEVLKVTLPQHLENAKAEDLCVWVDPLDG
TSEYTQGLVEHVTVLVGVALGDKAIGGVIHQPYFKNSENGTWGRTIWGIDGVGIGGFKPI
PPPEGKRIITTTRSHCDSTVQGALDALQSDEILRVGGAGHKVMLLLEGKAHAYVFASKGC
KRWDTCAPEAVLHSVGGTLTDLHGERYVYNSKTSYPNVGGVLATAPGQQHQWYLARIPNE
IKQRLV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagcggagccctgataacacgtctagtggcgtcttctgtaacagcagcaaca
agagctggtaaaataatcagagatgtaatgagtcaaggagaactgaatattgtggataaa
gggacaaatgatctacaaactgaagcagacaggtcagctcaaagatgtatcgtcacttct
ttaagtcaacaattcccaggtgttactatcattggtgaagaagaaccctcaaactgtgaa
gtaccatctgactgggtcgtcactgatatggatcaagaagttttaaaagtaactcttcct
caacacttggaaaatgctaaagctgaggatctttgtgtttgggtagatcctttagatgga
acttctgaatatactcaaggccttgtggagcatgtgactgttttggttggtgttgctctt
ggggataaagcgattggaggagtgatacatcaaccgtattttaaaaattctgagaatggt
acctggggtagaacaatatggggaatcgatggagtaggaatcggaggttttaaaccaatt
ccacctcctgaaggaaaacgaatcataactacaacacgttcacattgtgatagtactgta
caaggtgctttagatgctttgcagtctgacgaaatattgagagttggtggagctggtcat
aaagtcatgcttttattggagggaaaagctcatgcatatgtttttgctagtaaaggttgc
aaaagatgggacacttgtgctcctgaggctgtgttgcattcagtgggtggtactttaact
gaccttcatggtgaaaggtatgtttataactccaagacaagttatcccaatgtgggaggc
gtcttggctacagctccaggccaacaacatcagtggtaccttgcacgcattccaaatgaa
ataaagcagagactagtgtaa

DBGET integrated database retrieval system