KEGG   Nasonia vitripennis (jewel wasp): 100121321Help
Entry
100121321         CDS       T01081                                 

Definition
uncharacterized LOC100121321
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 626 aa AA seqDB search
MFPIGACQRRDSEAALYRRLVATVGDPDHYVRDRNSSSALLHDGLHLRAEWTTHKDKESS
SGIEGMSASSSHKLWRSTTGLDDAGMDLRVAQFSAHTSREFDSATTPAGLEQQLPLLVAL
CAIAGAILFAFLILLWLRQQMSREKDAEEGDRRGLVEEGTVCPPDDANKTTKTKALTEAK
WVPESVPEISAVVTAASENISTKFEKVIKTKVETETRWLAEPVPHVSTACVERTEAASTS
SSASSASIMATTKVPETRLAKRSPRRDCGGNRRTRSMYSSHVSAIATPERKPDPHRRCKG
LLERRGSSASLTIDLAPAPESPPHSVTPTRECTAEEYLLSATNRLTRDQLRKSVENPIAL
HTEFWKVPLNYPEEVDVCGSGVKNRYPTVLPNARSRVILPGSEDPLTSYINANYVRGYDD
ESRYIATQGPLSHTIADFWSMAWAERTPVIIMITRLHEAAKTKCEAYFPLELNSRIQAGP
FTVILNSMDTRGGYSVRDLEVRYENERRIIQHYWYDSWPDHLVPQTADALVGLAAEINTL
TGPIIVHCSAGIGRTGCFIALATGMTQLIREGNVDILRILCQMRYDRGGMVQTAEQYEFL
HKALCLFEETLERKTSKDDDRKEKPK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaatcggagcatgccagagacgagactcggaagctgcgctgtacaggagattg
gtcgccactgtgggcgacccggaccactatgtgcgcgaccgcaactccagctcggctctt
ctccacgacgggcttcacctaagggctgagtggaccacgcacaaggacaaagaatcatct
tccggcatagagggaatgtcagcgagttcaagtcacaaactctggcggtccacaacggga
ctggacgatgctggaatggatttgcgtgtggcgcaattcagtgcccataccagtcgggag
ttcgactctgccacgactccggcagggctggaacaacaactgcctctcctagtagctctc
tgtgccattgctggtgccatcctctttgctttcctgattctgttatggctgcgacagcaa
atgtcgcgtgagaaggacgctgaagaaggcgacaggcgtggtttggtggaggaaggcaca
gtctgtcctccggacgatgctaacaaaaccaccaaaacaaaagccctgactgaggccaag
tgggtacccgagtctgtcccagaaatctcagcagtagtaactgctgcctcggagaacatt
agcacaaagttcgagaaagttatcaaaacgaaggtagaaaccgaaacgcgatggctggcc
gagccggtgccacacgtctcgacggcatgcgtcgagcgcacggaggcggcctcgaccagc
tccagcgcgagcagcgccagtataatggccacgacgaaggtccccgagactcgtttggcg
aaacgctcaccccgtcgagactgcggtggcaatcgtcgcacccgatcgatgtactcgtcg
cacgtgtcggccatagcgacaccggagcgcaaacccgaccctcatcgacgctgcaaaggt
ctgctcgagcgtcgaggctccagtgccagtctcaccatcgacctggccccggctcccgag
agcccgccacacagcgtcacgccgacgcgcgaatgcaccgctgaggaatacttgctcagc
gccactaacagactaacaagagatcagctgaggaagtctgtcgagaatccgatcgctctg
cacacggaattctggaaagtgccgctgaactatcccgaggaggtagacgtctgcggatct
ggagtgaagaacaggtatcccactgttctgcccaacgcaagatccagagtcatactgccc
gggagcgaggatccactgactagttacattaacgctaattacgttagaggctacgacgat
gaatcgcgttacatagcaacgcaaggaccactgtcgcacacgattgcagacttctggagc
atggcttgggcagagcgaacgcccgtcatcatcatgataacacgacttcacgaagcggcc
aagaccaagtgcgaggcctacttcccgctcgagctgaactctcgcatccaagccgggcct
ttcactgtcatcctcaattcgatggacactcgaggcggctactcggtgcgcgacctcgag
gtcaggtacgagaacgagaggcgaatcatacaacattactggtatgattcatggccggac
catttggtaccgcagacggcggatgctctggtcggtctagccgcagaaattaacacgctg
actgggccgataatcgtgcactgcagcgccggtatcggtaggactggctgtttcattgct
ctggccactggtatgacgcaactgatccgcgagggaaacgtcgacattctacgaattctg
tgccaaatgaggtacgaccgaggaggtatggtccagaccgcagaacaatatgaatttttg
cacaaggcgctgtgcctcttcgaggaaacgctggaacgcaagacgtcaaaagacgacgac
cggaaagagaagccgaagtaa

DBGET integrated database retrieval system