KEGG   Nasonia vitripennis (jewel wasp): 100121321Help
Entry
100121321         CDS       T01081                                 

Definition
tyrosine-protein phosphatase non-receptor type 5-like
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100121321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
1
AA seq 625 aa AA seqDB search
MNGVDSSVRDSEAALYRRLVATVGDPDHYVRDRNSSSALLHDGLHLRAEWTTHKDKESSS
GIEGMSASSSHKLWRSTTGLDDAGMDLRVAQFSAHTSREFDSATTPAGLEQQLPLLVALC
AIAGAILFAFLILLWLRQQMSREKDAEEGDRRGLVEEGTVCPPDDANKTTKTKALTEAKW
VPESVPEISAVVTAASENISTKFEKVIKTKVETETRWLAEPVPHVSTACVERTEAASTSS
SASSASIMATTKVPETRLAKRSPRRDCGGNRRTRSMYSSHVSAIATPERKPDPHRRCKGL
LERRGSSASLTIDLAPAPESPPHSVTPTRECTAEEYLLSATNRLTRDQLRKSVENPIALH
TEFWKVPLNYPEEVDVCGSGVKNRYPTVLPNARSRVILPGSEDPLTSYINANYVRGYDDE
SRYIATQGPLSHTIADFWSMAWAERTPVIIMITRLHEAAKTKCEAYFPLELNSRIQAGPF
TVILNSMDTRGGYSVRDLEVRYENERRIIQHYWYDSWPDHLVPQTADALVGLAAEINTLT
GPIIVHCSAGIGRTGCFIALATGMTQLIREGNVDILRILCQMRYDRGGMVQTAEQYEFLH
KALCLFEETLERKTSKDDDRKEKPK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgtcgattcatcagtacgagactcggaagctgcgctgtacaggagattggtc
gccactgtgggcgacccggaccactatgtgcgcgaccgcaactccagctcggctcttctc
cacgacgggcttcacctaagggctgagtggaccacgcacaaggacaaagaatcatcttcc
ggcatagagggaatgtcagcgagttcaagtcacaaactctggcggtccacaacgggactg
gacgatgctggaatggatttgcgtgtggcgcaattcagtgcccataccagtcgggagttc
gactctgccacgactccggcagggctggaacaacaactgcctctcctagtagctctctgt
gccattgctggtgccatcctctttgctttcctgattctgttatggctgcgacagcaaatg
tcgcgtgagaaggacgctgaagaaggcgacaggcgtggtttggtggaggaaggcacagtc
tgtcctccggacgatgctaacaaaaccaccaaaacaaaagccctgactgaggccaagtgg
gtacccgagtctgtcccagaaatctcagcagtagtaactgctgcctcggagaacattagc
acaaagttcgagaaagttatcaaaacgaaggtagaaaccgaaacgcgatggctggccgag
ccggtgccacacgtctcgacggcatgcgtcgagcgcacggaggcggcctcgaccagctcc
agcgcgagcagcgccagtataatggccacgacgaaggtccccgagactcgtttggcgaaa
cgctcaccccgtcgagactgcggtggcaatcgtcgcacccgatcgatgtactcgtcgcac
gtgtcggccatagcgacaccggagcgcaaacccgaccctcatcgacgctgcaaaggtctg
ctcgagcgtcgaggctccagtgccagtctcaccatcgacctggccccggctcccgagagc
ccgccacacagcgtcacgccgacgcgcgaatgcaccgctgaggaatacttgctcagcgcc
actaacagactaacaagagatcagctgaggaagtctgtcgagaatccgatcgctctgcac
acggaattctggaaagtgccgctgaactatcccgaggaggtagacgtctgcggatctgga
gtgaagaacaggtatcccactgttctgcccaacgcaagatccagagtcatactgcccggg
agcgaggatccactgactagttacattaacgctaattacgttagaggctacgacgatgaa
tcgcgttacatagcaacgcaaggaccactgtcgcacacgattgcagacttctggagcatg
gcttgggcagagcgaacgcccgtcatcatcatgataacacgacttcacgaagcggccaag
accaagtgcgaggcctacttcccgctcgagctgaactctcgcatccaagccgggcctttc
actgtcatcctcaattcgatggacactcgaggcggctactcggtgcgcgacctcgaggtc
aggtacgagaacgagaggcgaatcatacaacattactggtatgattcatggccggaccat
ttggtaccgcagacggcggatgctctggtcggtctagccgcagaaattaacacgctgact
gggccgataatcgtgcactgcagcgccggtatcggtaggactggctgtttcattgctctg
gccactggtatgacgcaactgatccgcgagggaaacgtcgacattctacgaattctgtgc
caaatgaggtacgaccgaggaggtatggtccagaccgcagaacaatatgaatttttgcac
aaggcgctgtgcctcttcgaggaaacgctggaacgcaagacgtcaaaagacgacgaccgg
aaagagaagccgaagtaa

DBGET integrated database retrieval system