KEGG   Nasonia vitripennis (jewel wasp): 100121490Help
Entry
100121490         CDS       T01081                                 

Definition
neuropathy target esterase sws
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100121490
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100121490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 1406 aa AA seqDB search
MEVFIGVVELINRFNDSLGSYAFSRWIEHLIIEYQTSKTLLAVSIGILLSILAISIYVLR
KWKTKELLPQVREFVGVGTGRPRFRKRDKVLFYGRKMLRKVKSIGGQVPGTGQGKKRRAV
MRFARRLLQLKKDNAPQQLKVLEPPAEYLEEDVGPGDRVPPDALYILQSIRVFGHFEKPV
FLKLCKHTEIMNLPAGTPLFRIGDPDENVFIVQQGLVNVYITGSDGSQISLKLVKTGESV
TSLLSFTDVLTGHTSTYKTVAARAVEDSVVVKLPMSAFQEVFQDHPDAFVRVIQVIMVRL
QRVTFTALHQYLGLSAELVNQGSHKKKHSSVSQMGSPVRSRTRENFNLPVSENATSYPGA
SDLQQLDISVREFNSASQPVPIMSSRRSKTNLEWKTPNSGSQLSQHTSDIVPDCDSPWPN
SATSNQHSSHPGESSDGGVGVGSTGLHSGSASRKQSRIEGFQQPPLDEAQVVQIATEAFV
KELGLEDDTLLKEGKVQIREVPAGTYLMKEESHKDVALVFVVSGSLIISQRASEGREAGE
DVHMFSAHQGEIVGGLAVLTGEPSFYTIRAKHSSRIALLSKSTFFSIMREKPTVVLHVAK
TVVKRLSPFVRQVDFALDWLFLESGRAVYRQGDESDSTFIVLSGRLRSVITYENGKKELV
AEYGKGDLVGIVEMVTQTPRSTTVMAVRDSELAKLPEGLFNVIKLRYPIVVTRLINLLGH
RLLGTWKQAGPKNGSRDARRAVDARPSQVNFSTVAIVPITDDVPLTAFTYELYHSLCAIG
PCLRLTSDVIRKTLGSSIMESMNEYRLTSWLAQQEDQHRISLYQCDSNYTPWTQRCVRQA
DCILIVGLGDRPPTLGRTEREVERLAMRTQKELVLLHKEQNGQRPANTVQWLNMRSWVSS
HHHIQCPKRMFTRKSQYRINELYSKVLMSEPNVHSDFSRLARWLTGTSVGLVLGGGGARG
ASHVGMLKAIMEAGIPIDMVGGVSIGAFMGALWCMEKNITTTTQKAREWSKKMTQWWRQI
LDLTYPMTSMFSGKDFNKTIHGTFGDVYIEDLWLPYFTITTDITASCMRTHTHGSLWRYI
RASMSLSGYMPPMCDPTDGHLLLDGGYVNNLPGLLWKYIRASMTIAGVFPPICDPIDGHL
LVDGCYVNNVPADEMLRQGAHHILAIDVGSQDDTDLTNYGDSLSGWWLLWKRWNPFATPV
KVPNLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLQFANFDEIKDVGYNHGK
TYFEGQSKAGILPRFNADRENAKALRAKHQQAASQQAPSSYTFTDLAQMVCKVSRGNRYT
DIDSDSDGMEEYEADLEEDAQEVGYASEPTAGILDQSPEDARLRRRAGVSLSLSDTEADA
DLEYRMSGRNTPHQKFFKYGSSNLEM
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttttattggagttgtggagctgataaacagatttaatgacagccttggctcc
tacgcattttcaagatggatagaacatctgattatagagtaccagacatcaaagacactg
ctagcggtgtccattggtattctcttatcaattctggccatatcgatttatgtccttcga
aaatggaaaaccaaggagctcttgccacaagtcagagagttcgtaggtgtaggcacgggc
aggccaaggttcagaaagcgagacaaagtcttgttctatggaaggaaaatgctcaggaaa
gtcaagtccataggtggccaagtacccggcacaggccaaggaaaaaagagaagagccgtc
atgaggttcgctagaaggcttttacagttaaagaaagataatgctcctcagcaattgaaa
gtattagaaccaccagcagaatatttagaagaagatgttggtcctggtgacagagttcca
ccggatgctctttacattttgcagagtataagagtatttggtcactttgagaagccagtt
tttcttaaattgtgtaaacacacggaaatcatgaatttaccggcaggaactcctttgttc
agaattggagatccagatgaaaacgtgtttattgttcaacaaggtttagttaatgtttat
ataacaggttctgatggatctcagatctcacttaagttagtgaaaactggagaatctgtt
actagtcttctaagttttaccgatgtattaactggtcatacaagcacatacaaaacagta
gctgcacgagctgtggaagattctgttgttgtaaaattaccaatgagcgccttccaagaa
gtatttcaagatcatcctgatgcattcgttcgagttattcaagttatcatggtgagattg
caacgtgtaacatttacagcattgcatcaatacttaggtctttccgccgaattagttaat
caaggttcacataagaaaaagcatagttcagtctcccaaatgggctcgcccgtcagatcg
agaacgcgggaaaatttcaacctacccgtatcagaaaatgctacttcgtatccaggagct
tccgatttacaacaattggatatttctgtaagagaatttaacagtgcatcccagccagtt
ccaataatgtcaagccgaagatcaaaaacgaatttagagtggaaaactccaaactcgggt
tcgcaattgagccagcatacttccgatattgtaccggattgcgactcaccctggccaaac
tcagcgacttcgaatcaacattcgtcgcatcctggtgaatcgtccgatggtggcgtcggc
gtcggtagcactggcctacactccggcagcgctagtcggaaacaatctaggattgagggc
tttcagcagccgccgctggacgaggcgcaagtcgtccagatcgctaccgaggccttcgtc
aaagaattaggcctggaggatgatactctgctgaaagaaggcaaggttcagattcgggaa
gtaccggctggcacctacctaatgaaagaggaatctcacaaggatgttgcactggttttc
gtcgtgtcggggtcgttgataattagtcaacgagcctccgaaggtcgcgaggcaggcgaa
gatgtacatatgtttagcgcccatcaaggcgaaattgtaggcggattagctgttttaaca
ggcgaaccatcgttttatacaatcagagcgaaacactcgagtcgcatagctttacttagt
aaatccacatttttctctataatgcgagaaaaacctactgttgtattacacgttgcaaag
actgttgtaaaacgattgagtccattcgtcagacaggtcgattttgcactggactggttg
ttcttggaaagcggaagagccgtgtatcgtcaaggcgacgagtcagattcgacgttcatt
gtccttagcgggcgtctgcgatcggtcattacgtacgaaaatggaaaaaaggagttagtc
gccgaatacggaaaaggagatttagttggaatcgttgagatggtcacgcagactccaaga
tcaacgactgttatggcggtccgtgactcagaactagcaaaacttcctgagggtcttttt
aacgtcatcaaacttagatatccaattgttgtcacaagactgattaatttacttggtcat
cgattactcggcacttggaaacaagcaggccctaaaaatggttctcgtgatgcaagacga
gctgtggacgcgcggccatcacaagttaatttttctacagtggcaattgttccgatcacg
gatgacgttccattgacggcatttacttacgaactgtaccattctctgtgtgccatcggt
ccttgcttacgtctaacgtctgatgtcatacgaaaaactttgggctcttcgattatggag
tctatgaacgagtatcgattgacatcgtggctcgcccagcaggaagaccagcataggatc
tccttgtaccagtgtgactcgaattacactccgtggacgcaacgatgcgttcgccaggct
gactgtatcctgatagttggcctgggcgatcgaccgccgacacttggacgaacagagcgt
gaggtagagcgacttgctatgcgtacacagaaagaactcgtcttgctgcacaaggaacaa
aacggtcagcgaccggctaacaccgtacagtggcttaatatgaggtcatgggtgtctagt
catcatcatatccagtgtccaaagcgcatgtttaccagaaagtctcagtatcgtattaac
gaactgtactcgaaagtacttatgtcagaaccgaacgtgcacagtgacttcagtcggcta
gcacgatggctcacgggtacctcggtgggcttagttttgggcggcggcggggcccgaggt
gcctcgcacgttggcatgctcaaggctatcatggaagccggcatcccgattgacatggtt
ggcggcgtcagtattggcgccttcatgggtgcgctctggtgcatggagaagaacatcacc
acgacaacgcagaaagctcgagaatggtctaagaaaatgacacagtggtggaggcaaatt
ttggatcttacgtatccaatgacttcgatgttttccggcaaagatttcaataaaacaatc
catggcacttttggagacgtgtatatcgaggacttgtggcttccctattttacgataacc
actgatataaccgcttcttgtatgcgcacgcacacacacggatcgctttggcggtacata
cgtgcttcgatgtcattgtccggttatatgcctcccatgtgcgacccaaccgatggccac
cttctcctcgacggcgggtacgtcaataaccttccaggcttactttggaagtatattcga
gccagcatgacgattgccggtgtctttccgccaatttgtgatcctattgatgggcatctt
ttggtcgacgggtgttacgtaaataatgtcccagctgacgagatgctgagacaaggtgcg
caccacatcctcgccatcgacgttgggtcgcaggacgacaccgaccttaccaactacggg
gactcgctgtccggttggtggttactctggaagcgctggaaccccttcgccacccctgta
aaggtgcccaatttgccggacattcagtcacggttagcctacgtcagctgcgttcgacaa
ctcgaggaagtcaagaattcagattactgcgaatacatcaggccgcccatcgacaagtac
aagaccctgcagtttgccaacttcgacgagatcaaggacgtcggttataatcacggaaaa
acttactttgaagggcaatcaaaggcgggaatcctgccgcgcttcaacgccgaccgggag
aacgctaaggcactaagggccaaacaccaacaggctgcgagccagcaggccccgtcctcg
tatacgttcaccgatttggcgcaaatggtttgcaaagtgtcccgcggcaaccgctacaca
gacatcgactcggattcggacggcatggaagagtacgaggctgacttggaggaagacgca
caagaagttggatacgcttcagaacccaccgctggcattttggatcagagtccggaggat
gccaggctcagaaggagagccggagtttcgctcagtctctccgacaccgaggcggacgct
gatttagaataccgaatgagtggcagaaatactccacaccaaaagtttttcaagtacgga
agttccaatcttgaaatgtga

DBGET integrated database retrieval system