KEGG   Nasonia vitripennis (jewel wasp): 100121569Help
Entry
100121569         CDS       T01081                                 

Definition
(RefSeq) probable enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00062  Fatty acid elongation
nvi00071  Fatty acid degradation
nvi00280  Valine, leucine and isoleucine degradation
nvi00310  Lysine degradation
nvi00380  Tryptophan metabolism
nvi00410  beta-Alanine metabolism
nvi00640  Propanoate metabolism
nvi00650  Butanoate metabolism
nvi01100  Metabolic pathways
nvi01200  Carbon metabolism
nvi01212  Fatty acid metabolism
Module
nvi_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
nvi_M00085  Fatty acid biosynthesis, elongation, mitochondria
nvi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100121569
   00650 Butanoate metabolism
    100121569
  Lipid metabolism
   00062 Fatty acid elongation
    100121569
   00071 Fatty acid degradation
    100121569
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100121569
   00310 Lysine degradation
    100121569
   00380 Tryptophan metabolism
    100121569
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100121569
Enzymes [BR:nvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100121569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100121569
NCBI-ProteinID: XP_016836655
NASONIABASE: NV18054
Position
1
AA seq 293 aa AA seqDB search
MVNPAISRIIAGRASSLVKCASQTPKFYSSAAAPAYEFIKVEKTGAKNNVALITLNRPKA
LNALCAQLMSEMNLAIKQLDTDESVGAVVITGNERAFAAGADIKEMKDNTFSHNVKTSFL
EHWNGVAAAKKPTIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIAIGTIPGAGGTQ
RLTRAVGKSKAMEIVLTGQQITAQEAEKSGLVSKVVPAEQLVSEAVKLAEKIASHSQVAV
AMAKDSVNKAYETTLQQGLDYEKRLFWATFATADQKEGMKAFAEKRAPEFKNE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggttaacccagcaatcagccgtatcatcgccggccgggcatccagccttgtcaagtgc
gcttctcagactccaaaattctactctagcgccgcagcaccggcctacgaattcatcaag
gtcgagaagaccggcgcgaaaaacaatgtggccctgatcacgctgaaccggccaaaggcc
ctcaatgccctgtgcgcccagctgatgagcgagatgaacctggcgataaagcaactcgac
accgacgagtccgttggtgccgttgttattaccggcaacgagcgcgccttcgccgccggc
gccgacatcaaggagatgaaggacaataccttctcccacaacgtaaagaccagctttctc
gagcactggaacggcgtcgccgccgccaagaagccgactattgccgccgttaatggatat
gccctgggcggtggttgcgagctcgccatgatgtgcgacatcatctacgcgggcgacaag
gcaaagttcggccagccggagatcgcgatcggcacgattcccggagccggtggcacccag
cgcctgactcgcgccgttggcaagagcaaagccatggagatcgttctcaccggccagcag
attaccgcccaggaggccgaaaaaagcggactcgtcagcaaggtcgtcccggccgagcag
ctcgtgtccgaggccgtcaagctcgccgagaaaatcgcctcgcactcgcaggtcgccgtt
gctatggctaaagattccgttaacaaggcatacgagacgaccctccaacaaggcttggat
tacgagaagaggctgttctgggctaccttcgctactgctgaccagaaggaaggcatgaag
gctttcgccgagaagcgcgcgcctgagttcaagaacgagtaa

DBGET integrated database retrieval system