KEGG   Nasonia vitripennis (jewel wasp): 100121569Help
Entry
100121569         CDS       T01081                                 

Definition
probable enoyl-CoA hydratase, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100121569
   01212 Fatty acid metabolism
    100121569
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100121569
   00650 Butanoate metabolism
    100121569
  Lipid metabolism
   00062 Fatty acid elongation
    100121569
   00071 Fatty acid degradation
    100121569
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100121569
   00310 Lysine degradation
    100121569
   00380 Tryptophan metabolism
    100121569
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100121569
Enzymes [BR:nvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100121569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 146 aa AA seqDB search
MPQKLGMLTRKLNPEGVLPEIAIGTIPGAGGTQRLTRAVGKSKAMEIVLTGQQITAQEAE
KSGLVSKVVPAEQLVSEAVKLAEKIASHSQVAVAMAKDSVNKAYETTLQQGLDYEKRLFW
ATFATADQKEGMKAFAEKRAPEFKNE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaaattaggaatgttgacacgcaagctcaacccagagggcgtcttgccggag
atcgcgatcggcacgattcccggagccggtggcacccagcgcctgactcgcgccgttggc
aagagcaaagccatggagatcgttctcaccggccagcagattaccgcccaggaggccgaa
aaaagcggactcgtcagcaaggtcgtcccggccgagcagctcgtgtccgaggccgtcaag
ctcgccgagaaaatcgcctcgcactcgcaggtcgccgttgctatggctaaagattccgtt
aacaaggcatacgagacgaccctccaacaaggcttggattacgagaagaggctgttctgg
gctaccttcgctactgctgaccagaaggaaggcatgaaggctttcgccgagaagcgcgcg
cctgagttcaagaacgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system