KEGG   Nasonia vitripennis (jewel wasp): 100121588Help
Entry
100121588         CDS       T01081                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100121588
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100121588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
2
AA seq 661 aa AA seqDB search
MPSQTTTILLKCSMVDVPAINHVRLKSLYDSPGTLHKDVGGGTKVSVKSVGGVGSATLTS
LSSITNASNVSRNKNTPISHREVLLPSLGNSKTSSRVDRSDNNNANNTNANNIHLPIHDP
FNTNSHTDGYGLRLPMTPEQATKYYGSKLTEFERAEIEKYSEIWYLGLSACKIHGEEGAS
QNGGYDDDNGSYNKVLHDHISYRYEILEVIGKGSFGQVIRALDHKTGQHIAIKIIRNKKR
FHHQALIEVKILDHLRKKDLQANSSHNVIHMLEYFYFRNHLCISFELMSLNLYELIKKNN
YQGFSLSLIRRFANSLVNCLRLLHRENIIHCDLKPENVLLKQRGSSSIKVIDFGSSCYSH
QRVYTYIQSRFYRSPEVILGLPYGTPIDMWSLGCILAELYTGYPLFPGENEVEQLACIME
VLGRPPDQLINHASRRRLFFDSKGIPRCVTNSKGKKRRPGSKNVMIALRCRDPLFVDFVS
RCLEWDSKKRMTPEEAMRHEWLTSSSSSHLSSSSSTMASSITGSTALTSSGGVTESSQPV
HGQTAVSCGATSVSASVGVVQSVTSTAAARRRAETMEDPQQQYALYRLYRGRKCVSKITA
IDAPDGSGLVVKSKLNGSASSHALTAGTQPASSRHASTGDIVTSLDPSLDDSGTFLPHIL
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgccgagccagacgacgacgattctcctcaagtgctcgatggtcgacgtgccggctatc
aaccacgtgaggctcaagtctctgtacgacagtcccgggacgctacacaaagatgtcggc
ggagggacgaaagttagtgtcaaatcagtcggtggagtcggctccgcgaccctcacatcc
ctctcgtcgatcaccaacgcgagcaacgtcagcaggaacaaaaacacccccatatcgcac
cgtgaggtactgttgccttccctcgggaactcgaaaacatcgtcgcgggtggatagatcc
gacaacaataacgccaacaacacgaatgcgaacaacatccacctgccgatacacgacccg
ttcaacaccaactcgcacaccgacggatatggtctacgattaccaatgactccggaacag
gcgaccaagtactacggctcgaagctcacggaattcgagcgagccgagatcgaaaagtac
tcggagatctggtacctaggactgtccgcatgtaaaattcacggggaggaaggcgcctcc
cagaacggaggctacgacgatgataatggtagctacaacaaggtcctccacgatcatatc
tcctacagatatgaaatcctggaggttatcggaaaaggcagcttcggtcaagtgatcagg
gcgttagatcacaagaccggtcagcacatcgctatcaagatcataaggaacaagaagaga
ttccatcatcaggccctcatcgaagtcaagattttggatcatctcaggaaaaaggacctg
caggccaactcgtcccacaatgtgatacacatgctggagtacttctacttcaggaatcac
ctgtgcattagtttcgagctgatgagcttgaacttgtacgagctcataaagaaaaacaat
taccaaggctttagtttaagtctcatccgaaggttcgccaactcgctggtcaattgtctc
aggctgctccatcgagagaacatcattcactgcgatctgaaacccgaaaatgtattgctg
aagcagcgcggcagcagctcgatcaaggtgatagactttggctcgtcatgctacagccac
cagcgcgtctacacgtacatccagtcgaggttctatcgcagccccgaggtcatcctcggg
ctgccctacggcacgcccatcgacatgtggtccctcggttgcatcctcgcggagctctac
accggctacccgctcttccctggcgagaacgaggtcgaacaactcgcctgcatcatggaa
gtgctcggcaggcccccagaccagctcatcaatcacgcatcccgtcgcaggctcttcttc
gattctaagggaatccctcgttgcgtgaccaacagtaagggcaaaaagagaaggcctgga
agcaagaacgtcatgatagcactgaggtgtcgggacccacttttcgtcgatttcgtcagt
cggtgcctcgaatgggactcgaagaagcgaatgacccccgaagaggcgatgcgccacgag
tggttgacctcctcgtcctcgtcgcacctgtcatcctcctcgtcgacgatggcctcctcg
attacaggcagtacagctctgaccagcagcggcggtgtcaccgagtccagccagccagtt
catggccagacagcggtatcctgcggtgccacgagcgtctctgcaagcgtcggcgtcgtg
cagagtgtcacctcaacggcagccgcgcgtcgacgcgccgaaaccatggaggatccacag
cagcagtacgccctgtaccgattgtaccggggccgcaagtgcgtctcaaagatcacggcg
atagacgcaccggacggctcaggcctcgtcgtcaagagcaagctcaacggcagcgcaagc
agccacgccctcaccgccggtactcagcctgccagctcgaggcatgcctccaccggcgac
atcgtcaccagtctcgaccccagcctcgacgattcgggcacgtttctaccgcacatcttg
tcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system