KEGG   Nasonia vitripennis (jewel wasp): 100121740Help
Entry
100121740         CDS       T01081                                 

Definition
trifunctional enzyme subunit alpha, mitochondrial
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100121740
   01212 Fatty acid metabolism
    100121740
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100121740
   00650 Butanoate metabolism
    100121740
  Lipid metabolism
   00062 Fatty acid elongation
    100121740
   00071 Fatty acid degradation
    100121740
   01040 Biosynthesis of unsaturated fatty acids
    100121740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100121740
   00310 Lysine degradation
    100121740
   00380 Tryptophan metabolism
    100121740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100121740
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100121740
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100121740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 765 aa AA seqDB search
MASCRLFGALTRFSRTNVNFVTRAALYQPLRTLATEAKNKHFSYKVVEDVAVISIDSPGV
KVNTLNEEVMQEISTILRDVESNPAVRSAVLISGKPNCFIAGADISMLQKVKDEQTLYKI
SKDGHEILNKIAESKKPIVAAIQGSCLGGGLEVAMACHYRIAVKDDKTGLGLPEVMLGLL
PGGGGTQRLPKLVSLPNALDMPLTGRTVKADKAKKFGLVDLLVNRLGPGVATAEENTKQY
LEETAVKVAKDIANGKLKIDRSPKNWVEKLTNQVMGIEFVKDQIFKKAKAQVMKQTNGLY
PAPLKILEVIRTGLDKGPQVGYEAEAKGFAELAITPQSKGLISLFFGQTECKKNRFGAPK
TPAKTVAVVGAGLMGAGIAHVSIDRGYNVILKDTNDAGLNRGVAQIQTGLNNAVKRKRIN
SIEKGRLLANLTPTLSYDQFRNADIVIEAVFEDLGIKHKVIKEIESRTPEHCIVATNTSA
IPITKIAAGSGRPDKLIGMHYFSPVDKMQLLEIITHKGTSEETIKSAVDVGLKQGKVVIT
VGDGPGFYTTRILSAMATEGVRLMQEGVDPMDLDQLTKKFGFPVGAATLSDEVGIDVGSH
ISVDLVKALGDRFRGGNENILVEMVKAGYLGRKSGKGIFVYETGSKHRDINPGALDILKK
YSLQPLGSTSDEDRQLRMVSRFVNEAVLCLQEKILANPLEGDIGAVFGLGFPPFTGGPFR
WVDYYGAHKLVNKMEEFMAHYGEPFKPCDLLYDMAKNPQKKFHPQ
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctgtcggctattcggtgcgctcacgcgcttttctcggaccaatgtcaacttt
gtcacacgtgcagctctgtatcagccactgcggacgctggctacagaagctaaaaacaag
catttttcatacaaagtcgtcgaagatgtagctgtaatttctatcgactcccctggagtc
aaggtgaacactttaaatgaagaagtaatgcaagaaatatccacaattttgagagatgtt
gagagtaaccctgcagttcgatcagctgtattgataagtggaaagccaaactgctttatt
gctggtgccgatatttcaatgctgcaaaaagttaaagatgagcagactctatataaaatt
tccaaggacggtcatgaaattttgaataaaattgcagaaagtaagaaacccatcgtagct
gctattcagggcagttgcttgggtggaggtttagaggtagctatggcttgccattaccga
attgcagtgaaagatgacaaaactggcttaggattgccagaagtaatgcttggtcttctg
cctggtggcggtggaactcaaaggcttccgaaattggtttcccttccaaatgcactagat
atgcctttgactggtagaacagtaaaagctgataaagcgaagaaatttggtcttgttgac
cttcttgtaaatagattgggtccaggagtagcgacagctgaggaaaacacaaagcaatat
ttggaagaaactgccgtgaaggtggcaaaagacattgcgaacggtaaactaaagattgac
agaagtccaaagaattgggtagaaaaactaaccaatcaagtaatgggcattgaatttgtg
aaagatcaaatctttaagaaagcaaaagcacaagtaatgaaacagaccaatggcctttac
ccagctccattaaaaattttagaagttattcgaactggtttggacaagggtccccaagtg
ggctatgaagcagaggccaaaggatttgctgaattagctataacacctcaaagtaaaggt
ttaatcagtcttttcttcggccaaacagaatgcaagaagaatcgttttggagcccctaaa
actccagcaaagactgttgcagttgtaggagctggtttgatgggtgcaggtatcgctcat
gttagtattgataggggttacaatgttatacttaaggacacaaacgatgctggattaaac
agaggtgttgctcaaatccaaacaggcttgaacaatgctgtgaagaggaaacgtataaac
agcattgagaaaggaagattgcttgctaatctaactccaaccttgtcttacgatcagttc
cgaaatgctgatatcgtcattgaagccgtattcgaagatcttggaatcaaacacaaagtt
atcaaagaaatcgagtctagaactccagaacactgtattgttgccaccaatacgtctgct
attccaataacaaaaattgctgctggaagtggacgtccagacaaacttattggcatgcat
tacttttctcctgtcgacaaaatgcaattattagaaataataacgcacaaaggtacttca
gaggaaaccataaagtctgctgtagatgttggtttaaagcaaggaaaagtagtgataact
gttggagatggtcccggattttacacgacgagaatcttatctgccatggctactgaaggt
gtaagactgatgcaggaaggcgtcgatcctatggatttagatcagcttacgaagaaattc
ggtttccccgtgggagccgccactttgtccgacgaagtcggtattgatgtaggctcgcac
atcagcgttgatcttgtaaaagctctcggagacagattccgtggtggaaacgagaatatt
ctagttgaaatggtcaaggcaggatatttaggccgaaaatctggcaagggtatcttcgtt
tatgagactggttcgaaacacagggacattaatcctggtgcacttgatattctgaagaag
tacagcctgcaacctctcggcagcacttctgatgaagacagacaattaagaatggtgtct
cgattcgttaacgaagctgtattatgtttgcaagaaaagattttagccaaccccttggaa
ggtgacattggtgctgtatttggacttggattcccgccattcactggaggacctttccgc
tgggtcgattattacggtgcccataaattagtcaacaaaatggaagagttcatggcccac
tatggcgaaccctttaagccatgcgacttgctttatgatatggccaagaacccccagaag
aaattccatcctcagtaa

DBGET integrated database retrieval system