KEGG   Nasonia vitripennis (jewel wasp): 100121753Help
Entry
100121753         CDS       T01081                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100121753
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100121753
Chaperones and folding catalysts [BR:nvi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100121753
Membrane trafficking [BR:nvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100121753
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100121753
  Exosomal proteins of colorectal cancer cells
   100121753
  Exosomal proteins of bladder cancer cells
   100121753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 OST3_OST6 AhpC-TSA ERp29_N Redoxin TraF Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 100121753
NCBI-ProteinID: XP_001605359
NASONIABASE: NV10123
UniProt: K7IM38
Position
1
AA seq 496 aa AA seqDB search
MKFTLSLFAVLACLLGAAFAKIETEDEVLVITKDNFDEALEKHPYILLEFYAPWCGHCKA
LAPEYAAAAKKLVEQNSEVKLGKVDATIESDLAEKHKIRGYPTLKFYRKGSQIEYTGGRK
ADDIINWVLKKTGPIAKDLSTVDEAKAFIEANNVAVVGFFKDAESENAKVFLEVANSIDD
TVFAISSNADVFAEYGVEDGKVVLFKKFDDNKAEFADEHNVANLKKFIQVESLPLIVEFN
QETARTIFNGDIKSHLLVFLSQEAGHFDKYADDLKTPAKEFRGKVLFVTINADDADHERI
LEFFGMKKDNTPAMRLIQLEEDMAKYKPENSEISADNVKEFVSAFLDGKLKRHLLTQDLP
EDWDKNPVKVLVGTNFAEVAYDKSKNVLVEFYAPWCGHCKQLAPIYDQLGEKYKDNEKVV
IAKMDATVNELEDIKIASFPTITLYKAETNEAVEYNGERTLEGLSKFIDSDGAYGEGADE
TEEEDEDDDAPRKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacgctgtcactgttcgccgttttggcatgcctccttggggctgctttcgcc
aagatcgagaccgaggatgaggtcctcgtcatcaccaaggacaacttcgacgaggctctc
gagaagcatccctacatcctcctcgagttctatgctccatggtgcggacactgcaaggcc
ctggccccagagtacgcagcagctgccaagaagctggttgaacagaactctgaagtcaag
ttgggtaaggttgatgccaccatcgagagtgacttggctgagaagcacaagatcagggga
taccccactctgaagttctaccgcaagggatcacagattgaatacactggtggtcgcaag
gctgatgacatcatcaactgggtactcaagaagactggaccaatcgccaaggacctgtca
accgttgatgaggctaaggccttcattgaggctaacaatgttgccgttgttggtttcttc
aaggatgctgaatccgaaaacgctaaggtcttcttggaagttgccaactccatcgacgac
accgtattcgctatctccagcaacgccgatgtcttcgctgaatacggcgtcgaagacggc
aaggtcgttcttttcaagaagttcgacgacaacaaagccgaattcgctgacgagcacaat
gtcgccaacttgaagaagttcatccaggtcgaatctctgcctttgatcgttgagttcaac
caagaaactgcccgcaccatcttcaacggtgacatcaagagccacctccttgtattccta
agccaagaagctggtcactttgacaaatacgccgacgacctgaagactcccgccaaggaa
ttccgtggaaaggtcctcttcgttaccatcaacgccgacgatgctgatcacgagcgtatc
ctcgaattcttcggaatgaagaaggacaacactcccgccatgcgcctcatccagttggaa
gaggatatggccaagtacaagcctgaaaactccgaaatcagcgccgacaacgtcaaggaa
ttcgtcagtgccttccttgatggcaagctcaagaggcacctcctcacccaagacctgccc
gaagactgggacaagaaccccgtcaaggttctcgtcggaaccaacttcgccgaagtcgca
tacgacaagtccaagaacgtcctcgttgaattctacgccccatggtgcggacactgcaaa
cagcttgctcccatctacgaccagcttggtgagaagtacaaggacaacgagaaagtagtc
atcgctaagatggacgccaccgtcaacgaattggaagacatcaagatcgctagcttcccc
acgatcactttgtacaaggctgagacgaacgaggctgtcgaatacaacggtgagaggaca
cttgaaggtctttccaaattcatcgactctgatggtgcttacggagaaggtgctgatgag
actgaagaagaagatgaggacgatgatgctccacgaaaggacgagctgtga

DBGET integrated database retrieval system