KEGG   Nasonia vitripennis (jewel wasp): 100121753Help
Entry
100121753         CDS       T01081                                 

Definition
protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100121753
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100121753
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100121753
  Exosomal proteins of colorectal cancer cells
   100121753
  Exosomal proteins of bladder cancer cells
   100121753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 496 aa AA seqDB search
MKFTLSLFAVLACLLGAAFAKIETEDEVLVITKDNFDEALEKHPYILLEFYAPWCGHCKA
LAPEYAAAAKKLVEQNSEVKLGKVDATIESDLAEKHKIRGYPTLKFYRKGSQIEYTGGRK
ADDIINWVLKKTGPIAKDLSTVDEAKAFIEANNVAVVGFFKDAESENAKVFLEVANSIDD
TVFAISSNADVFAEYGVEDGKVVLFKKFDDNKAEFADEHNVANLKKFIQVESLPLIVEFN
QETARTIFNGDIKSHLLVFLSQEAGHFDKYADDLKTPAKEFRGKVLFVTINADDADHERI
LEFFGMKKDNTPAMRLIQLEEDMAKYKPENSEISADNVKEFVSAFLDGKLKRHLLTQDLP
EDWDKNPVKVLVGTNFAEVAYDKSKNVLVEFYAPWCGHCKQLAPIYDQLGEKYKDNEKVV
IAKMDATVNELEDIKIASFPTITLYKAETNEAVEYNGERTLEGLSKFIDSDGAYGEGADE
TEEEDEDDDAPRKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacgctgtcactgttcgccgttttggcatgcctccttggggctgctttcgcc
aagatcgagaccgaggatgaggtcctcgtcatcaccaaggacaacttcgacgaggctctc
gagaagcatccctacatcctcctcgagttctatgctccatggtgcggacactgcaaggcc
ctggccccagagtacgcagcagctgccaagaagctggttgaacagaactctgaagtcaag
ttgggtaaggttgatgccaccatcgagagtgacttggctgagaagcacaagatcagggga
taccccactctgaagttctaccgcaagggatcacagattgaatacactggtggtcgcaag
gctgatgacatcatcaactgggtactcaagaagactggaccaatcgccaaggacctgtca
accgttgatgaggctaaggccttcattgaggctaacaatgttgccgttgttggtttcttc
aaggatgctgaatccgaaaacgctaaggtcttcttggaagttgccaactccatcgacgac
accgtattcgctatctccagcaacgccgatgtcttcgctgaatacggcgtcgaagacggc
aaggtcgttcttttcaagaagttcgacgacaacaaagccgaattcgctgacgagcacaat
gtcgccaacttgaagaagttcatccaggtcgaatctctgcctttgatcgttgagttcaac
caagaaactgcccgcaccatcttcaacggtgacatcaagagccacctccttgtattccta
agccaagaagctggtcactttgacaaatacgccgacgacctgaagactcccgccaaggaa
ttccgtggaaaggtcctcttcgttaccatcaacgccgacgatgctgatcacgagcgtatc
ctcgaattcttcggaatgaagaaggacaacactcccgccatgcgcctcatccagttggaa
gaggatatggccaagtacaagcctgaaaactccgaaatcagcgccgacaacgtcaaggaa
ttcgtcagtgccttccttgatggcaagctcaagaggcacctcctcacccaagacctgccc
gaagactgggacaagaaccccgtcaaggttctcgtcggaaccaacttcgccgaagtcgca
tacgacaagtccaagaacgtcctcgttgaattctacgccccatggtgcggacactgcaaa
cagcttgctcccatctacgaccagcttggtgagaagtacaaggacaacgagaaagtagtc
atcgctaagatggacgccaccgtcaacgaattggaagacatcaagatcgctagcttcccc
acgatcactttgtacaaggctgagacgaacgaggctgtcgaatacaacggtgagaggaca
cttgaaggtctttccaaattcatcgactctgatggtgcttacggagaaggtgctgatgag
actgaagaagaagatgaggacgatgatgctccacgaaaggacgagctgtga

DBGET integrated database retrieval system