KEGG   Nasonia vitripennis (jewel wasp): 100121765Help
Entry
100121765         CDS       T01081                                 

Definition
GTP cyclohydrolase 1-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nvi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 232 aa AA seqDB search
MKTEKSENGQQNGAENGCQNGNCRSGHEKCTFHHDMELDHRPPTREALLPQMSHSYKLLL
QALGENTERQGLLKTPERAAKAMLFFTKGYDQSLEDVLNDAIFDEDHDEMVLVKDIEMFS
MCEHHLVPFYGKVSIGYLPCKKILGLSKLARIVEIYSRRVQVQERLTKQIAEAVTKAIAP
AGVAVVVEGVHMCMVMRGVQKINSKTITSTMLGVFRDDPKTREEFLNLVRAK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgagaagagcgaaaacggacagcagaacggagccgagaacggatgtcagaat
ggcaactgtcgttcaggtcacgagaagtgcacgttccatcacgacatggaactggaccat
aggccaccgacccgcgaggctctgctgccccagatgtcccacagttacaagctcctgttg
caggcgctcggcgagaacaccgagagacagggtctgctcaagacgcccgagagggctgcc
aaggctatgctgttcttcaccaagggctacgatcagagtctcgaggatgtcttgaacgac
gccatattcgacgaggatcatgacgagatggtcctcgtgaaggacatcgagatgttttcc
atgtgcgagcaccacctcgtgccgttctacggtaaggtctccatcggctacttgccctgc
aagaagatcctgggactgagcaaacttgcaagaatcgtcgagatatacagcagacgagtg
caggtacaggaacgtctgacgaagcagatcgccgaggctgtgaccaaagctatcgcgccg
gctggtgttgccgtggtcgtcgaaggagtgcacatgtgcatggtcatgcgaggcgtacag
aagatcaacagcaagacgatcacctcgactatgctcggcgttttccgcgacgatcccaag
acccgcgaggagttcctcaacctcgtgcgtgcgaagtaa

DBGET integrated database retrieval system