KEGG   Nasonia vitripennis (jewel wasp): 100121765Help
Entry
100121765         CDS       T01081                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100121765
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100121765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
3
AA seq 232 aa AA seqDB search
MKTEKSENGQQNGAENGCQNGNCRSGHEKCTFHHDMELDHRPPTREALLPQMSHSYKLLL
QALGENTERQGLLKTPERAAKAMLFFTKGYDQSLEDVLNDAIFDEDHDEMVLVKDIEMFS
MCEHHLVPFYGKVSIGYLPCKKILGLSKLARIVEIYSRRVQVQERLTKQIAEAVTKAIAP
AGVAVVVEGVHMCMVMRGVQKINSKTITSTMLGVFRDDPKTREEFLNLVRAK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgagaagagcgaaaacggacagcagaacggagccgagaacggatgtcagaat
ggcaactgtcgttcaggtcacgagaagtgcacgttccatcacgacatggaactggaccat
aggccaccgacccgcgaggctctgctgccccagatgtcccacagttacaagctcctgttg
caggcgctcggcgagaacaccgagagacagggtctgctcaagacgcccgagagggctgcc
aaggctatgctgttcttcaccaagggctacgatcagagtctcgaggatgtcttgaacgac
gccatattcgacgaggatcatgacgagatggtcctcgtgaaggacatcgagatgttttcc
atgtgcgagcaccacctcgtgccgttctacggtaaggtctccatcggctacttgccctgc
aagaagatcctgggactgagcaaacttgcaagaatcgtcgagatatacagcagacgagtg
caggtacaggaacgtctgacgaagcagatcgccgaggctgtgaccaaagctatcgcgccg
gctggtgttgccgtggtcgtcgaaggagtgcacatgtgcatggtcatgcgaggcgtacag
aagatcaacagcaagacgatcacctcgactatgctcggcgttttccgcgacgatcccaag
acccgcgaggagttcctcaacctcgtgcgtgcgaagtaa

DBGET integrated database retrieval system