KEGG   Nasonia vitripennis (jewel wasp): 100121805Help
Entry
100121805         CDS       T01081                                 

Gene name
Cpr
Definition
cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100121805 (Cpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 695 aa AA seqDB search
MDLPTVDASLPKAVRMSGSPVLPGGQDSGEIVDEPMFSTLDMILLGFLLLVAAWWLLKRN
KQEEYTSATKSYTIQPTSYTALTPSENSFIKKLQSSGRSLVVFYGSQTGTGEEFAGRLAK
EGIRYKLKGMVADPEECDMEELVNMKSIPNSLAVFCLATYGEGDPTDNAMEFVDWLKNGD
ADLNGLNYAVFGLGNKTYEHYNEVALYVDHRLEQLGANRVVECGLGDDDANIEDDFITWK
DKFWPAVCEYFNIEGAGEDVSIRQYKLTEHNDMPADKVYSGEIARLHSFKNQRAPYDAKN
PFLAPVKINRELHGPTSERSCMHIEFNIEGSKMRYEAGDHLAVYPVNSAELVNKLGAKCQ
VDLDTVITLTNTDEESTKKHPFPCPCTYRTALTHYLDITSNPRTHILKELAEYCSDPADK
ERLKLMSSTTAEGKALFQQWVIQENRNIVHILEDVPSLKPALDHLCELLPRLQCRYYSIS
SSPKLHPNEIHITAVVVEYKTPTGRINRGVTTSWLKEKHPSDPPCLVPIFVRKSQFRLPS
RTTTPVVMIGPGTGIAPFRAFIQERDVAKKDGKEVGDTILYFGCRKRDEDFLYHEELQQY
VDSGTLTLHTAFSREQANKVYVTHLLEQNKEELWRVIGEKNGHIYVCGDARNMARDVHNI
LLKVVMEKGNMTELQAADYIKRMDSQKRYSSDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccgaccgtggacgcgtcgctgcccaaagccgtgaggatgtccggctcccct
gtgttgcccggtggccaggactccggcgagatcgtcgacgagccgatgttcagcaccctg
gacatgatcctgctcggcttcctcctgctcgtcgccgcctggtggctgctcaagcggaac
aagcaggaggagtacacctccgccaccaagtcctacaccatacagccgacctcgtacacg
gcgctcacgccctcggagaactcgttcatcaagaagctccagagctccgggcgcagcctg
gtcgtcttctacggcagccagaccggcaccggcgaggagttcgccggccgactcgccaag
gaaggcatccgctacaagctcaagggcatggtcgccgaccccgaggagtgcgacatggag
gagctggtcaacatgaagtccatacccaacagcctggccgtcttctgcctggcgacctac
ggcgagggcgaccccaccgacaacgccatggagttcgtcgactggctgaagaacggcgac
gccgacctcaacggcttgaattacgccgtgttcggacttggaaacaagacctacgagcat
tacaacgaagtcgctctctacgttgatcacagactcgagcagctgggagccaatcgcgtt
gtggagtgcggtcttggagacgatgatgcaaacatcgaagatgatttcatcacgtggaag
gacaagttttggccagccgtttgcgagtacttcaacatcgaaggcgccggcgaagacgtt
agcattcgtcagtacaaactcaccgagcacaatgatatgccagctgacaaggtttacagc
ggcgagatcgcccgtctccactcgttcaagaaccaaagagcaccgtacgatgccaaaaat
cccttcttggcacccgtcaaaatcaaccgcgagctccatggtcccacctccgagcgctcg
tgcatgcacatcgaattcaacatcgaaggctccaagatgcgctacgaagctggagaccat
ttggctgtctatcccgtcaacagcgctgaactggtcaacaaacttggcgccaagtgtcaa
gttgatctcgacactgtcatcactttgaccaacactgatgaggagtctaccaagaagcac
ccgttcccttgtccttgtacctaccgaactgcgctgacgcattacttggacatcaccagc
aaccctcgtacgcacattctcaaagaacttgcggagtactgcagcgatcccgctgacaag
gaaaggctcaaactgatgtcttccaccaccgccgaaggcaaagctctcttccaacagtgg
gtcatccaagaaaacaggaatattgtgcacattttggaggacgttccaagcttgaagcca
gctctcgatcacctttgcgagttgttgccaagactgcaatgccgctactactcaatttct
tcctcgcccaagttgcacccgaacgaaattcacatcactgctgtggtcgtggagtacaag
actccaactggtaggatcaatcgaggtgtaacgactagttggctgaaggagaagcatcct
tcggatcctccttgccttgtgccgatttttgtccgcaagtcccaattccgcttgccatcg
cgcaccactactccggttgtcatgatcggacctggaactggaatagcgccgttcagagca
tttatccaagagcgcgatgtcgctaaaaaagacggcaaagaagtcggtgacacgattctt
tactttggttgccgaaagcgcgacgaagacttcctctatcacgaagaactgcaacaatat
gtggatagtggaactctaactctgcacaccgcgtttagtagggagcaggccaacaaggtt
tatgtgacacatttgctagagcagaataaggaagaattgtggagagttatcggggaaaag
aatgggcacatctatgtttgcggtgatgcgcgcaacatggcacgtgacgtacacaacatc
ctcttgaaggtggtaatggagaagggaaacatgaccgagcttcaagctgctgactacata
aagaggatggattcgcagaagcgttactccagtgacgtatggagttga

DBGET integrated database retrieval system