KEGG   Nasonia vitripennis (jewel wasp): 100121829Help
Entry
100121829         CDS       T01081                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:nvi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 1298 aa AA seqDB search
MSLLVSLRGSRGDSDESSDGSSTTMPPPSTVSVRSIKNILKHMENDVDWRMPLAFNKPRH
TVTIEGVNCISQTWRMKERMKTVSVALVLCLNVGVDPPDIVKTQPCARLECWIDPLSLSP
QKALETIGSNLQKQYERWQPRARYKQSLDPTVEEVKKLCTSLRRNAKEERVLFHYNGHGV
PKPTSNGEIWVFNRTYTQYIPLSVYDLQTWMGAPSIYVYDCSNAGIIVDSFQQFADQHEK
EYELEKQAIQQNRTAGAVPLTAPSYKNCIQLAACAANQILPMNPDLPADIFTSCLTTPIK
IALRWFVMQNTSKLVPKVSLDLIDKIPGQLTDRRTMLGELNWIFTAITDTIAWNTLPRDL
FQRLFRQDLLVASLFRNFLLAERILRSYDCTPVSCPKLPPTYQHPMWQAWDLALDLCLAQ
LPNILESEDRFVHSPFFEEQLTAFQVWLVLGSKNRNPPEQLPIVLQVLLSQVHRLRALEL
LGRFLDLGPWAVNLALSVGIFPYVLKLLQSNAKELRPLLVFIWAKILAVDNTCQADLVRD
HGHKYFLSVLQDTSMQSEYRTLAAFVLACIVNNYPPGQEAALQGSLVSICLEQLGDANPL
LRQWLCLCLARLWHNYDKARWCGVRDIAHEKLYNLLQDPVPEVRAASVYALGTFINSVTK
RSEHANNIDQTIAMMLINTVTYDMCPLVRKELVVALQWMVLHFENSFVTLAIAEENSRRD
LVVETLSPFSGMRRIGSKDRLKMLSPNSTYSIDTTDGFGPDKIKRVSSVSSISSLGHSSL
GNLPSLSYGSVYMKLWHGLCGLDNDPHPGVSQMAQKVTNYIRSQVKESSAPKEVGDAKMS
SSLSLPPSPSNRTNYLSNSKGESPPTVASATDLLRSTRLSTHTSRARKPIPNTISEESDE
VPGIKCPLITSQFVEWSCAQFAQPVSFDAEAESTNDVESRAHHEREWRYSRNKKQRREVK
EEQLKAVNGRIESHAFQWRCPQPPEVLLFHPFDSHLAVACKDYFGIWDYQSGSKLTYHPS
RGTRPSKITTLEFINSHDVALLMVGSDDGSIRVWKNYYNMLGREPILLTAWQALGDLQPV
VKGSTGTAGLVTSWEQQSLTLAVTGDVKSVRLWNAETELKVQDIPTGADCCVTCLDTDNA
GNMMVLGCGDGSVRVFDRRLPATESRVMTYREHNAWVLGAYLKKSASSPIRLITGSSSGD
IRFFDLRKNSSVNMVQTTHGITSFVMHESADIFGCSTNQCISMYNISGNHLNTIKFHEGF
MSTRIGPASCLSFHPHRVVLAAGCVDNTVIAYGLEHRR
NT seq 3897 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctactcgtgtcgttgcgcggcagccgcggcgacagcgatgagagtagcgacggt
tcatccacgacgatgccacccccgtcgacagtgtcggtcaggtcgatcaagaacatactc
aagcacatggaaaacgacgtggactggcgcatgccgttggcattcaacaagccaaggcac
accgtcaccatcgagggtgtcaactgcatcagccagacctggcgcatgaaagaacggatg
aaaaccgtgagcgtcgccctggtgctctgcctgaatgttggcgtcgatcctccggacatc
gttaagacacagccctgcgctcgactcgagtgctggatcgatccactgtcgttgagtcct
caaaaggctctcgagaccataggttctaatctgcagaagcaatacgagaggtggcagcct
agagccagatataaacagagcttggatccaacagtagaggaggtcaaaaagctctgtacg
tctttgagaaggaatgctaaggaggagcgagtactttttcattataatggtcatggtgta
ccaaagcctacgagtaatggagagatatgggtattcaataggacatatactcagtacatt
cctctgtctgtgtacgacttacaaacttggatgggagcccctagtatttatgtatacgat
tgttctaatgcaggtataattgttgattcttttcaacagtttgctgatcagcatgaaaag
gagtatgagttggaaaagcaagctattcaacaaaacagaacagcaggtgctgttccattg
acagccccgtcctataagaattgtattcagttggcagcttgtgcagccaatcaaatttta
cctatgaatccagatcttccagcagatatattcacatcttgccttacaactcctattaaa
attgcattacgctggtttgtaatgcaaaacacatccaagttggtgccaaaagtatcacta
gacctcatagacaaaatacctggtcaattgacagatagaaggactatgttaggagaactc
aactggatttttactgctattacagatactatagcatggaatacactacctagagattta
ttccaaaggttatttagacaagatttactggttgctagtttatttagaaattttttatta
gctgagcgaatattacgatcctatgactgtacaccagtttcttgtccaaagctgcctccc
acatatcagcatccaatgtggcaggcatgggatttagctctagatttgtgtttagcacaa
ttaccaaatattttagaatcggaggatcggtttgttcactcgccattttttgaagaacag
cttactgcttttcaagtttggcttgtattaggttccaaaaatcgtaatcctccagagcag
cttcctatagttctacaagtattgcttagtcaggtgcacagactcagagcattggaattg
ctaggacgattccttgatctagggccatgggcagtcaatttagctttgagcgttgggatc
tttccttacgtgctaaaattattgcaaagcaatgccaaggaacttcgacccctcctggtt
ttcatttgggctaaaatacttgctgtagataatacttgtcaagctgatttagtacgtgac
catggccataaatattttttgtccgttttgcaagatacctcaatgcagagtgaatacaga
acattggcagcttttgtacttgcttgtatagttaacaattatcccccgggtcaagaagct
gccttgcaaggtagtttagtatctatttgtctagagcagcttggggatgctaatcctcta
ttaaggcagtggttatgcttgtgccttgcgcgcttatggcacaattatgataaagctagg
tggtgtggcgtacgagatattgcgcacgaaaaactttataatctcttgcaagaccccgtg
ccagaggttcgcgctgccagtgtgtatgcattaggaacttttataaacagcgtgacaaaa
cgaagtgaacacgccaacaatattgaccaaactattgctatgatgttaattaatacagtg
acctacgatatgtgtcctctagtcagaaaagaattggtagtagctcttcagtggatggtt
ttgcattttgaaaattcctttgttaccttggccattgctgaagaaaatagcagaagagat
ctggttgtcgaaactctttcacctttcagcggcatgagaagaatcggttccaaagatagg
ctaaaaatgctgtcgccgaacagtacttatagtatagacacgaccgacggattcggtcct
gataaaatcaaacgagtttcttcagtttcatcgattagcagcttaggccacagttctctc
ggaaacttgcctagtctttcatacggaagcgtctatatgaaactttggcatggattatgc
ggacttgataatgatcctcatcctggcgtttctcaaatggcacaaaaagttacaaattac
attcgaagtcaggtaaaagaatcatcggctccaaaagaagtaggcgacgctaaaatgtcg
tcatctttatcgttacctccgtctccatccaacagaactaattatttgagcaatagtaaa
ggggaatcaccgcctaccgtagcgtcagcgacggaccttttacggtctacgagattgtca
actcatacaagtcgtgcaagaaaacctataccaaatacgatatcggaagaatcggatgag
gtaccaggaatcaagtgtccattaataacctcgcaatttgttgaatggagttgtgcccaa
tttgctcaacccgtgagttttgatgcagaagccgagtccacgaacgacgttgagagtcgc
gcgcatcacgaacgcgagtggcggtactcgcgaaacaaaaagcagagaagggaagtaaaa
gaggaacagttgaaggcagtaaatggacggatagagtcacatgcatttcaatggcgttgt
ccgcaaccaccggaagttttactttttcatccttttgactctcacttagccgtggcatgt
aaagattattttggaatatgggattatcaaagtggatcaaaacttacgtaccacccaagt
cgaggaactagaccatctaaaataacaactttggaattcatcaattcccacgacgtagca
ttattgatggtaggatcagacgatggctctattagagtttggaaaaattattacaatatg
ttaggacgtgagcctatacttctgaccgcttggcaagctctgggtgatcttcagccggtt
gttaagggctctacaggcactgcgggtctggtaacgagctgggagcagcaatctttgaca
ctagcggtaacaggtgacgtaaaaagtgtgcgactatggaatgccgaaacagaattgaaa
gtgcaggacattcctacgggtgctgattgttgcgttacttgtctagatacagacaatgca
ggtaacatgatggtgcttggctgtggagatggttcggtacgcgtgtttgatagaaggttg
ccggctacggaatcgagagttatgacttacagagagcacaatgcatgggttctgggggcg
tatctgaaaaaatctgcgagttcaccaatcagactgataacgggatcttcttctggtgac
attcgatttttcgatctcaggaaaaactcatctgttaatatggtccaaacgacacatgga
ataacgtccttcgtgatgcatgaatctgcagatatttttggatgttctacaaaccagtgc
atcagtatgtataatatatcaggtaatcacctcaacacaatcaagtttcacgagggcttc
atgagcacgaggatcggccctgcaagttgtcttagttttcatccacatcgggtcgttttg
gccgctggttgcgttgataacactgtgatcgcttacggccttgagcatcgcagatga

DBGET integrated database retrieval system