KEGG   Nasonia vitripennis (jewel wasp): 100121925Help
Entry
100121925         CDS       T01081                                 

Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100121925
Translation factors [BR:nvi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100121925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 704 aa AA seqDB search
MAKKRVPLWPPGDESSKNPDDEPNFSDPDDFDDDIPDEELLEDLLPQKPSETEGVDSIIV
IDGVPKVEPKRLEKLQSVIEKIYGKFGTIVSKSYPQDSNGMTIGYVFFEYSDPTSALNAV
KQANNYKIDKVHTFKVNLFSDFKKYENIPEDWKPPEPQRFQPFTDLHNYLLDPDAYDQFC
IAVGSNGGAPNVQIWQNCQPEPVCVEDRARWTDTYVKWSPLGTYLATFHKLGVALWGGSN
FTQQMRFLQRGVECIDFSPNERYLVTYSPRAEADEKRLVMWDILTGQEKRSFLPEGPNVW
PIFRWSHNDKYVAYMGEDVLSVYETPSFGLLDKKSIKIPGIRDFSWSPTDNIIAFWVPED
KDVPARVTLMEIPSRNEIRKNNIFNVADCKIFWQKSGDYLCVKVDRFAKKKEKTEQKYTE
SCKFQTLQHFQGMSYNFEIFHMREKLTPVDSLEIKEPIHAFAWEPVGNKFAIIHGETSSV
NVSFYEVRCGHRPTLLKKLEKKACNHLFWSPSGQFIVLAGLTTMSGALEFIDTNDFTIMN
LTDHYQTSDVEWDPTGRYVVTSVASWKTSVDNGYWLWTFQGRILKRVNLHQFHQFMWRPR
PPTLLTPEQIKDIKKNLKKYSAQFESKDRLRLTRASKELIEKRCALMKEFESYRADCIER
WNKQKKRRMELRQNIDTDELDSDTKNMDEEVVEFFVKEETFEEK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaagagtgcctctttggccgccgggcgacgagtccagcaaaaatccggac
gacgagcccaacttcagcgatcccgatgactttgacgacgacatacccgacgaagaactt
ctggaagacctcctgccgcagaagccatctgagacagaaggtgttgattcgatcattgtc
atcgatggagttcccaaggttgagccgaagcggctggaaaagctccagtctgtcattgag
aagatctacggcaagtttggcaccattgtcagtaagtcctatcctcaggattcaaatggg
atgaccataggatatgtgttcttcgagtacagcgaccccaccagtgccttgaatgcagtg
aagcaggccaataactacaagattgataaggtgcataccttcaaggtaaatctcttctct
gacttcaagaagtacgagaacattcctgaggactggaagccacctgagccacaacgtttc
cagcccttcacggatcttcacaactatctgctggatccagatgcgtacgatcaattctgt
attgctgttggtagcaatgggggagctcctaacgtccagatctggcagaactgtcagcca
gagcctgtttgcgttgaggaccgtgctcgctggacggacacgtacgtcaagtggtcgcca
ctgggtacctacttagccaccttccacaagcttggtgttgctctgtggggaggttccaac
tttacgcagcagatgaggttcttacagcgtggtgtcgaatgcatcgacttctcgccgaac
gagcgttaccttgtgacctattcgccacgcgcggaggccgacgaaaagcgactcgttatg
tgggacatccttactggacaagagaaacgatccttcttaccagagggtcccaatgtctgg
cccatcttccgttggtcccacaatgataagtacgtcgcctatatgggcgaagatgttctc
agtgtgtacgagacgccgtcatttggtctattggacaagaagagtataaagatcccgggt
atccgggacttcagctggtcgccgaccgacaacatcattgccttctgggttcccgaagac
aaggatgtacccgccagggtgacacttatggaaattcccagtcgtaacgaaatccgtaag
aacaatatcttcaatgttgctgactgcaagattttctggcagaagtccggtgattatttg
tgcgtgaaagtcgaccgtttcgccaagaagaaggagaagaccgagcagaaatacacggag
agttgtaaatttcaaacgttgcaacactttcagggaatgtcttacaactttgaaatcttc
cacatgcgcgagaaacttacccccgttgacagcctagaaattaaagaaccaattcacgct
ttcgcatgggagcctgttggcaacaaatttgccattattcacggagaaacatcgtcggtg
aacgttagtttttacgaagtgcgctgtggacatcgtcccacgctacttaaaaaactggaa
aagaaagcgtgcaatcacttgttctggtcgccttcgggtcaattcatcgtgctggccggt
cttacaaccatgtccggtgccctggaattcatcgacaccaatgacttcacgatcatgaac
ctgacggatcactaccagacttccgacgtggagtgggatcctactggacgttacgtagtg
acgtcggtagcgagctggaaaacgagcgtagacaacggttactggctctggacgttccag
ggcagaattctgaagagggttaaccttcaccagttccatcagtttatgtggcgcccaagg
ccgccaactctgcttacccccgagcagatcaaggacatcaagaagaacctcaagaaatat
tcggcgcaattcgagagcaaggatcgcctccgtctcacgcgcgcttcaaaggaactaatc
gagaaacgttgcgcgttgatgaaagagttcgagagctaccgcgcggattgcattgaacga
tggaacaagcagaagaaacgtcgtatggaattgcgtcaaaatatcgacacagatgaattg
gattcagataccaagaatatggatgaggaggttgtggaatttttcgtcaaggaagaaact
tttgaagaaaaataa

DBGET integrated database retrieval system