KEGG   Nasonia vitripennis (jewel wasp): 100121967Help
Entry
100121967         CDS       T01081                                 

Gene name
AChE-2, CCE-J2, Nv1605568
Definition
acetylcholinesterase 2
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100121967 (AChE-2)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100121967 (AChE-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
3
AA seq 664 aa AA seqDB search
MRRPGRRLPALLLLVLLAARASGAEEQDDLFGATHSHISGGNHRARQISGMGSEYVEDPL
IVETTSGLMRGLSRTILDREVHVYYGVPFAKPPVGPLRFRKPEPLEPWHGVLNATLLPNS
CVQERYEYFPGFEGEEMWNPNTNTSEDCLYMNLWVPKKLRLRHKGGGESTERSLNGMPIL
VWIYGGGYMTGTATLDVYDADMMAARSDAIIASMQYRVGAFGFLYLSDYLGKASDEAPGN
MGLWDQAMALKWLKDNAKVFGGDPNLITIFGESAGGGSVSLHLMSPVTRGLVRRGILQSG
TLNAPWSFMSAERANEVARILVNDCKCNASMLEDSPSEVMACMRQVDAKTISVQQWNSYG
GILGFPSAPTIDGVFLPKDPLDLLREEDFEKTEIIIGNNENEGTYFILYDFIDYFEKDNP
SPLDRSKFLQIINTIFKNMSSIEREAIAFQYTEWENTNDEFMYQRMVADIVGDYFFICPS
IHFAQLFADRGMKVYYYFFTQKSSTNLWGSWMGVMHGDEIEYVFGHPLNTSLRYTERERE
LSKKMILAYSNFAVHGKPMRDENQWPPYTREQPNYYIFNAEKNGMGKGPRTTACAFWNEF
LPRLKGIPDPSPESCNSSSGGASVASSISAGAWGLTSSSALTSVWLALALSCLLLLRSGQ
QLVI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgccccgggaggaggctgccggcgctgctgctgctggtcctgctggcagcgcgg
gccagcggcgccgaggagcaggacgacctgttcggcgcgacgcacagccacatcagcggc
ggcaaccaccgcgcgcgccagatcagcggcatgggcagcgagtacgtggaggacccgctg
atcgtcgagacgacgagcggcctcatgcgcggcctctcgcgcaccatcctcgaccgcgag
gtgcacgtctactacggggtgccgttcgccaagccgcccgtcgggccgctgcgcttccgc
aagcccgagcccctcgagccctggcacggcgtgctcaacgccacgctcctgcccaacagc
tgcgtgcaggagcgctacgagtacttcccgggcttcgagggcgaggagatgtggaacccg
aacaccaacacgagcgaggactgcctctacatgaacctctgggtgccgaagaagctgcgg
ctcaggcacaagggcggcggcgagtcgaccgagcgctcgctcaacggcatgccgatcctc
gtctggatctacggcggcggctacatgaccggcaccgcgaccctcgacgtctacgacgcg
gacatgatggccgcgcgcagcgacgcaatcatcgcctcgatgcagtaccgggtcggggcg
ttcggcttcctctacctcagcgactacctcggcaaggcctcggacgaggcgcccggcaac
atgggcctctgggaccaggcgatggcgctcaagtggctcaaggacaacgccaaggtcttc
ggcggcgaccccaacctcataacgatcttcggcgagtcggccggcggcggctcggtctcg
ctgcacctcatgtccccggtgacccggggcctcgtgcgccggggcatcctccagagcggc
accctcaacgcgccctggagcttcatgagcgccgagcgggctaacgaggtcgcgcgcatc
ctcgtcaacgactgcaaatgcaacgcgagcatgctcgaggacagcccctcggaggtgatg
gcctgcatgcgccaggtcgacgccaagaccatctcggtgcagcagtggaacagctacggc
ggcatcctcggcttcccctccgcgcccacgatcgacggcgtcttcctgcccaaggacccg
ctcgacctgctgcgcgaggaggacttcgagaagaccgagatcatcatcggcaacaacgag
aatgagggaacgtatttcatactttacgacttcatcgactacttcgagaaggacaatcca
agcccactggatcgcagcaagtttctccagatcatcaatacgatattcaaaaacatgtcc
agcatcgagcgggaggccatcgcgttccagtacaccgagtgggagaacacgaacgacgag
ttcatgtaccagaggatggtggctgacatcgtgggcgactacttcttcatctgtccttcc
atacatttcgctcagctgttcgccgatcgcggaatgaaggtctactactacttcttcacg
cagaagtcgagcaccaacctgtggggcagctggatgggggtgatgcacggcgacgagatc
gagtacgtgttcgggcatccgctgaacacgagtctgcgttacaccgagcgcgagcgcgag
ctctccaagaagatgatattggcctactccaatttcgccgtgcatggaaagccgatgcga
gacgagaaccagtggccgccgtacacgagggagcagcctaactactatatcttcaacgcc
gagaagaacggcatgggcaagggccctaggacgaccgcctgcgcgttctggaacgagttc
ctgccgcggctgaaaggcataccagatccatcgccggagtcgtgcaacagtagcagcggc
ggcgcgtcagtggcatcgagcatctcggcaggcgcctggggactgaccagcagcagtgcg
ctgacgtcggtttggctggctctggccctgagttgtcttctgctgttgcgaagcggtcaa
cagctggtcatctag

DBGET integrated database retrieval system