KEGG   Nasonia vitripennis (jewel wasp): 100122105Help
Entry
100122105         CDS       T01081                                 

Definition
multifunctional protein ADE2-like
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nvi00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 421 aa AA seqDB search
MTDYKLGKLIIEGKTKKVFELANDPKLCYLESKDRITAGDGVKSHELEGKAAISNATNAK
VFQLLNQAGIKTAFVKLAGEKSFISKKCEMVPIEWVTRRLATGSFLKRNPGVPEGFRFNP
PLQETFFKDDENHDPQWSQEQIVSAGFKLNGVTIGKDEYDIMLRTTLVVFEVLERAWATR
DCALIDMKIEFGIDADGEILLADIIDSDSWRLWPSGDKRLMKDKQVYRNLATVTQSDLET
VKRNFKWVADQLEYLVPPPSAHVIIFMGSPSDEEHCKKIAKHATALGLKAQLRVSSAHKG
TEETLRILAQYEGSGEKVVLVAVAGRSNGLGPVLSGNTPFPVINCPPGNSQDIDQDVWSS
LKVPSGLGCTTVLYPESAALAAAQIHALHDHLVWSRLRVKQLTNFITLKKADAKLRNVQQ
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattacaagttgggcaagctcatcatcgagggcaagacgaagaaggtcttcgag
cttgcgaacgacccgaagctctgctacctggagagcaaggatcgcatcaccgccggagat
ggcgtcaagtcccacgagctcgagggcaaggctgccatcagcaatgccaccaatgccaag
gttttccagctactcaaccaggccggtatcaagactgccttcgtcaagctcgctggagag
aagagcttcatctcgaagaagtgcgagatggtacccatcgagtgggtcaccaggaggctg
gccactggaagcttcctcaagaggaacccaggtgtccccgaaggcttcaggttcaaccca
cccctacaggagaccttcttcaaggacgacgaaaaccacgaccctcagtggtctcaggag
cagatcgtctcggccggtttcaagctgaacggcgtgaccatcggtaaggacgagtacgac
atcatgcttcgcaccaccctcgtcgtcttcgaggtgttggagcgggcctgggccaccaga
gactgcgcgctgatcgacatgaagatcgagttcggtatcgatgccgatggtgagatcctc
ctggccgacatcatcgacagcgactcctggaggctctggcccagcggcgacaagaggctg
atgaaggacaagcaggtctacagaaacctggctaccgtcacgcaatccgacctggagacg
gtcaagcgtaacttcaagtgggttgccgaccagctggagtacctggtcccacccccaagt
gctcacgtaatcatcttcatgggctcgcctagcgacgaggagcactgcaagaagatcgcc
aagcacgctacagctctgggtctcaaagcccagctccgtgtgagcagtgcacacaaggga
accgaggagaccctccgaatcctcgcccagtacgagggtagcggcgagaaggtggtgctg
gtcgcggtggctggcagaagcaacggcctaggtccagtgctctctggcaacaccccgttc
cctgtcatcaactgcccgccaggaaactcccaggacatcgaccaggacgtctggtcttct
ctcaaagtgccttcaggactcggatgtacaactgtgctgtacccggaaagcgcagccctc
gctgctgcccaaattcacgctctccacgatcatctggtctggtctcgtctgcgggtcaaa
cagctgacgaacttcatcactctgaaaaaggctgacgctaaactgaggaacgtccagcag
ttctaa

DBGET integrated database retrieval system