KEGG   Nasonia vitripennis (jewel wasp): 100122108Help
Entry
100122108         CDS       T01081                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100122108
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100122108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 429 aa AA seqDB search
MRGIPIRSSASSLSLGNMAKMLDFYSQFNPSPLSIKQFIDFGLSACERKSFIFLRKELPV
RLANIMKEIHLLPENLLRMPSVGIVNNLYVTSFEEIIHFEKADVNDTTLDTFCQALVKIR
NRHTDVVQTMAQGVLELKESHDVDAQTENSIQYFLDRFYMSRISIRMLINQHTLLFGGVL
NGHNRHIGCIDPYCDVISVVKDAYENARFLCDQYYMASPDLVVQQHNGKFAKKLERGNEI
KIVYVPSHLYHMLFELFKNSMRAVMEYRGQDADNYPPLEVTVVRGKEDICVKMSDRGGGI
PRSQMDNLFKYMYSTAPQPSKSDAHTVPLAGYGYGLPLSRLYARYFMGDLVLLSCEGFGT
DAIIYLKALSNEANELLPIFNKTSTKFYRTPLPTADWSNQCGNSMSTRQMTMSHNQGHRL
PSGLQAGHC
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggaattccaataaggagcagcgcgagtagtctctccctcggcaacatggccaag
atgctcgacttttactcccaattcaacccctcgcccctctcgataaagcagtttatcgat
tttggacttagtgcgtgcgagaggaagtctttcatatttctgaggaaggaacttccggtc
cgcttggccaacatcatgaaggagattcacttgctgccggagaatctgcttcgaatgccg
agtgttgggatcgtaaacaacctgtacgtcacatcttttgaagagattatacattttgag
aaagctgacgtgaatgatactaccctggatacattttgtcaggcactagttaagataaga
aacaggcacaccgatgtcgtgcagactatggctcagggtgttctggaattaaaagaatct
cacgacgtggacgcgcaaaccgagaacagcattcagtatttcctcgacagattctacatg
tcgcgaatttccataagaatgctcatcaatcagcacaccctacttttcggaggagtgttg
aacggccataatcgtcacatcggctgcatagatccgtattgcgatgttatcagcgtcgtg
aaggatgcttacgagaacgctcggttcttgtgtgatcagtactacatggccagtcctgat
cttgttgtccagcagcataatggcaagtttgctaaaaagctggaacgtggaaacgaaata
aaaatcgtatatgtgccaagtcacttgtatcacatgctctttgaactgttcaaaaacagc
atgagagcagtaatggaataccgcgggcaagatgctgacaattatcctccccttgaagtg
actgtggttcgtggaaaagaagacatatgcgtcaaaatgtctgaccgaggtggcggcatt
ccgcgctctcagatggataatttgttcaaatacatgtatagtacagctcctcagcctagc
aagtctgatgcccatacggttccgcttgctggatacggttatggtcttccattatcccga
ttgtacgcccgctatttcatgggtgatctagttttactaagctgtgaaggctttggaact
gatgccataatatatttgaaggcattgtcgaacgaagctaacgagttgttacctatattc
aataaaacttcgacaaaattctacagaaccccgcttcccactgctgactggagcaatcaa
tgcggcaacagcatgtcaactagacagatgaccatgagccacaaccaaggacataggctt
cctagtggcttgcaggctggtcattgctag

DBGET integrated database retrieval system