KEGG   Nasonia vitripennis (jewel wasp): 100122177Help
Entry
100122177         CDS       T01081                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nvi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nvi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
4
AA seq 184 aa AA seqDB search
MQVKLKLIAAACENMGIGVNGDLPWRLRKEMDFFTKMTSTTKDENKKNVVLMGRRTWESI
PKKFKPLSNRINMVLTSQPLDLGEDAIVCKNLPEAIEKISQSPLKDKVEQVWVIGGSLVY
KTSMESPNFYRLYLTRVKKDFKCDAFFPEIPNDYILVKDPEVPEGIQEEKDIKFEYEVYE
KKQN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaaattgaaattaattgcggcggcatgcgagaacatgggaatcggcgtcaac
ggagatttgccgtggcgtttgagaaaagaaatggatttcttcacgaaaatgacatcgaca
acgaaagatgagaataaaaaaaatgtagttttgatgggtaggagaacttgggaaagtatt
cctaagaaatttaaacccctgtcaaacaggataaacatggtgctcacatcccagccactt
gacctgggtgaagatgctattgtatgcaagaatttgcctgaagcaattgaaaagatttct
cagagtcctttgaaagataaggttgaacaagtatgggtcattggaggtagtttagtctac
aaaaccagtatggagtcacccaatttctataggctttatttaactagagtaaaaaaagat
tttaaatgtgatgccttcttcccagagattccaaatgattacatattagtaaaagatcca
gaagtccctgagggaattcaagaagagaaggacattaaatttgaatacgaagtgtatgag
aagaaacagaattga

DBGET integrated database retrieval system