KEGG   Nasonia vitripennis (jewel wasp): 100122177Help
Entry
100122177         CDS       T01081                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100122177
   00670 One carbon pool by folate
    100122177
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100122177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 184 aa AA seqDB search
MQVKLKLIAAACENMGIGVNGDLPWRLRKEMDFFTKMTSTTKDENKKNVVLMGRRTWESI
PKKFKPLSNRINMVLTSQPLDLGEDAIVCKNLPEAIEKISQSPLKDKVEQVWVIGGSLVY
KTSMESPNFYRLYLTRVKKDFKCDAFFPEIPNDYILVKDPEVPEGIQEEKDIKFEYEVYE
KKQN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaaattgaaattaattgcggcggcatgcgagaacatgggaatcggcgtcaac
ggagatttgccgtggcgtttgagaaaagaaatggatttcttcacgaaaatgacatcgaca
acgaaagatgagaataaaaaaaatgtagttttgatgggtaggagaacttgggaaagtatt
cctaagaaatttaaacccctgtcaaacaggataaacatggtgctcacatcccagccactt
gacctgggtgaagatgctattgtatgcaagaatttgcctgaagcaattgaaaagatttct
cagagtcctttgaaagataaggttgaacaagtatgggtcattggaggtagtttagtctac
aaaaccagtatggagtcacccaatttctataggctttatttaactagagtaaaaaaagat
tttaaatgtgatgccttcttcccagagattccaaatgattacatattagtaaaagatcca
gaagtccctgagggaattcaagaagagaaggacattaaatttgaatacgaagtgtatgag
aagaaacagaattga

DBGET integrated database retrieval system