KEGG   Nasonia vitripennis (jewel wasp): 100122192Help
Entry
100122192         CDS       T01081                                 

Gene name
Cdk4
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100122192 (Cdk4)
Protein kinases [BR:nvi01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   100122192 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
4
AA seq 368 aa AA seqDB search
MAGRARPANAEIDPDLSTPTAAKRSKLGATPGSSASQEDESLKQTPLGNELGDLETSEVL
PSSDESFGEDDDKGKIRIGAKLEAKKEGDSPAASSSTATGDKKTLPTSTLREIAALKQLE
RFEHPQIVKLLDVCQGNYLQLPSGDGMTDRINRGLTLWLVFEHVERDLSSFLTACQSRKI
PSQLAKQMSREILLGVDFLHSHRIVHRDLKPQNLLVTKDGHVKIADFGLAKTYDFEMKLT
SVVVTLWYRAPEVLLACPYATPIDIWSVGCILAELNELKPLFPGTSEADQLDKIFRIIGT
PPESEWPENVSLGWSAFPFRHSKPMKTIIPNLSDAGLDLIKNMLIFNPHKRLTAARALQH
PYFLEDES
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctggtagagcacgacctgcaaacgcggagatcgatccggatctttcgacaccgact
gcagccaagaggtcgaaactcggcgcaacacccggcagcagtgccagccaagaggacgag
agcctgaagcagacgcctctgggaaacgagctcggcgatctagaaacgtccgaggttcta
ccctcctcggacgagtctttcggcgaggacgacgacaagggcaagatcaggatcggcgcg
aagctcgaagcgaaaaaggaaggagacagtccggcagcctcttcgtcgacagccactggt
gacaagaaaacgctgccgacctcgacgctccgagagatcgccgccctcaagcagctcgag
aggttcgagcatccgcagatcgtgaaactcctcgatgtctgccagggtaactacttgcag
ttgccctcaggagatggaatgaccgatcggataaaccgcgggttaactctgtggctggtt
ttcgaacacgtcgagcgagatctgtcgtcttttttgacggcctgtcagtcgcgcaagatt
ccatcgcagttggccaagcagatgtccagggaaattctactgggagtggattttcttcac
agccacaggatcgtgcacagagatctcaagccgcagaatttgttggttaccaaggatggc
cacgtcaagatcgctgattttggtcttgccaagacgtacgatttcgagatgaaattgact
tcggtcgtcgtgacgctttggtatcgggccccggaagttctcctggcatgcccctatgcc
actccaatcgacatttggtctgtcggctgtattctcgccgaacttaacgaactgaagccg
cttttccctggaaccagcgaagcagatcaattggacaaaatttttagaatcatcggaacg
ccaccggaatcagaatggccagagaacgtgtcgttgggctggtcagcatttccattcaga
cattccaagcctatgaaaacgataattccgaacctgagtgatgcaggacttgatctcata
aaaaatatgctcatttttaatcctcacaaacgtcttacggcagctcgagctctccagcat
ccgtattttctcgaggatgaatcttga

DBGET integrated database retrieval system