KEGG   Nasonia vitripennis (jewel wasp): 100122278Help
Entry
100122278         CDS       T01081                                 

Definition
28S ribosomal protein S18b, mitochondrial
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Ribosome [BR:nvi03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100122278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 208 aa AA seqDB search
MSFVRLTLQAIGNAGRTGLHRVISARGISQSFVRCEQQQAQLEDNVNEEGAEVDSEPKVD
PRSDRSKVIPVETSISYLESEAYKLAYGDDPVWKHYRRNFKGQFAPTRTRKTCVRNKVIT
TSNPCPICRDEYLVLDHRNTKLLNQFISPYNGELLQTKKTGLCRKQHENLEVAIYRAKDY
GTISFDVPFRTYDYSEWYNPEAESNNKE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgttcgactgactctacaagctattggtaacgcaggccgcactggattgcat
cgggttatatcagcgagaggtatttcacagagcttcgttcgctgcgaacagcaacaagca
caactcgaagacaatgtaaatgaggaaggtgctgaagtcgactctgagccaaaggttgat
cctagaagtgatagatccaaagttatcccagtcgaaactagtatttcatatcttgagagc
gaagcttataaactagcttatggggatgatccagtatggaaacattatcgaagaaacttt
aagggtcagtttgctccgacacgaaccagaaaaacttgtgtaagaaacaaagttattacc
acgagtaatccttgtcctatatgcagagatgaatatttggtattagatcataggaatact
aaactgctaaatcaatttatttctccatacaacggtgaactcctgcaaacaaaaaaaact
ggtctttgccgaaagcaacatgagaatcttgaagtcgctatttacagagctaaggattat
gggaccataagttttgatgttcccttcagaacatatgattactctgaatggtataatcct
gaagctgaatctaataacaaggaatag

DBGET integrated database retrieval system