KEGG   Nasonia vitripennis (jewel wasp): 100122289Help
Entry
100122289         CDS       T01081                                 

Definition
probable beta-hexosaminidase fdl-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nvi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:nvi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:nvi00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:nvi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nvi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:nvi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 696 aa AA seqDB search
MRFNMITHKSSREPDKGTPRETHEFARMVGSVPSGWMRRVLLFLVLVTGVLLIAMFAHTP
PLASLQPFTARSLKDLRRSMVTLVVSADDEEIASESPRQRLYELPEDVPRANRTFQSPWS
WACVAGRCERRSVRSSRISLATCTAMCGGNSRLLWPKPSGRVDLGTDHLVFHWQQVELST
VNTSNQDVRDLLEQAKDVFMGNLRSLVRAPNAKSRSAVDSFVIYLSAGAVQDARLTLDTD
ESYHLQVLTKGKHLEVRIIGKSYYGVRHGLETFSQMIWWDEACSKQGCLRVLSQASVEDK
PAFAYRGLLVDTGRQFFSLEQLKRVIDGMSASKLNTFHWHLSDSQSFPYDSAQFPEMARW
GAYSGDEVYTPEDVKELATYARIRGVRVLVEIDSPAHAGAGWQWGVEHGLGELALCVDQQ
PWSAYCGEPNCGQLNPINENSYKILEGLYRELLDLTEVRDIVHLGGDEVNLDCWAQYSNI
SAAMQAQNMTDYHVLWAEFEKKLHSRLIKANHGEAPKAVILWSSPLTKRPYITQYLDSSV
HVIQSWGGSNWPDTPDLLEDGFRVILSHVDAWYLDCGFGRWRETGEAACGEYRTWQTVYN
HRPWRDYPPQQQHLLLGGEAAIWAEQLGQASLGPRLWPRASALAERLWSDLPSSGYTTDE
SVYTRLSAHIELLRSRGVRTEAMWPHWCTQNPGKCL
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcaatatgattacacacaaatcgtcaagagaacccgataagggcaccccaaga
gaaacacacgagttcgcgagaatggtgggtagcgtgcctagcggctggatgaggcgggtc
cttctctttctcgttcttgtcaccggagtgctcctcatcgccatgttcgcccacacgcca
ccgcttgcatcgctgcagcccttcaccgcacgcagtctgaaggatctgcgccgaagcatg
gtcaccctggtagtctccgccgacgacgaggaaatcgcctccgagagtcctcgccaacga
ctttacgaactcccggaggacgtacctcgtgccaataggacgttccagagtccctggtcg
tgggcctgcgtggctggaaggtgcgagcgtcgttcggtgcgcagctctcgcatctccctg
gcgacctgcacggccatgtgcggcggcaactcgaggctcctctggccgaaaccgtcggga
agagtcgacctcggtaccgaccacctcgtctttcactggcagcaggtcgagctctccacc
gtcaacaccagtaaccaggacgtcagggacctgttggaacaagccaaggatgtgttcatg
ggaaacctgaggagtctggtgcgagcgccgaacgccaagagccgctcggcggtcgacagc
ttcgtgatctaccttagtgccggcgcagtccaggacgcgcgactgactctggacaccgac
gagtcctatcacctacaagtacttaccaagggcaaacacctcgaggtgcggataatcggc
aaatcatactacggcgtgcgccacggcctggagacgttctcgcagatgatctggtgggac
gaggcttgtagcaaacagggctgcttgcgagtcttatctcaggccagtgtcgaggacaag
ccggccttcgcctatcgcggccttttggtcgacaccggcaggcagttcttcagcctcgag
cagctcaagcgcgtgattgatggaatgtccgcctccaagctgaacaccttccactggcac
cttagcgactcgcagagctttccttacgactcggcgcagtttccggagatggccaggtgg
ggagcttacagcggcgacgaggtctacacgcccgaggacgtcaaggagcttgcgacttat
gccaggatacgcggcgtcagggtcctcgttgagatcgattcgccggctcacgctggcgcc
ggatggcaatggggtgtggagcacggactcggggagttggctctgtgcgtggaccagcag
ccgtggtcggcgtactgcggcgagccgaactgcggccagctgaatccgatcaacgagaac
tcgtacaagatcctcgagggtttgtatcgggagctactcgacctgacggaggtgcgagac
atcgtccaccttggaggcgacgaggtcaatctcgactgctgggcccagtacagcaacatc
agcgcggctatgcaggcgcaaaacatgaccgactaccacgtgctctgggctgagtttgag
aagaagttgcattcgcgcctgataaaagcgaaccacggcgaggctccgaaagcggtgatc
ctctggagctcgcctcttacgaagcggccgtacataacgcagtacctggactcgtcggtg
cacgtgatacagtcctggggtggtagcaactggccggacacgccggacctgctggaggac
ggtttccgggtgattctgtcgcacgtggacgcttggtacctggactgcggtttcggtcgc
tggcgagagacgggcgaagccgcctgtggggagtaccgtacctggcagaccgtttacaat
cacaggccctggcgggattacccgccccagcaacagcatctgctgctgggaggagaggcc
gccatctgggccgaacagctgggacaggcgtcgctgggacctcgactatggcccagggcg
tccgccctcgctgaaagattgtggagtgacctgccttcaagcggctacaccacggatgag
agcgtatacacacgactgtcggcccacatcgagctgttacgctcgcggggagttaggact
gaggcgatgtggcctcactggtgcactcagaatcctggaaaatgcctctga

DBGET integrated database retrieval system