KEGG   Nasonia vitripennis (jewel wasp): 100122308Help
Entry
100122308         CDS       T01081                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100122308
Chromosome [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100122308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 980 aa AA seqDB search
MIVIDSDTTDCVTNSVILCFLQLWEQQKQLEEQRREKERLEALRKKDKHDHSAVASTEVK
QRLQSFLVNKKQREAAAAANGAVPGTPGYRTWLQSQSDSSSSTTASHPYRMPQILQEKFG
DDFPLRKTASEPNMLKVRLKQRVMERNMAASRNSPLMARRKDRLLSHLKRRSLLANSGSN
PESGPNSPPTVGNSQSSPTAAGGSGGGGSSTPIQEESEAAAYGGQLSSASQQGSLSDLSL
FSSPSMPNISLGRPHVPSSSTSGSKLATVSEAEVRAAFTARLGMPLTGQMLPGTLPFYPS
LTVIDGEPTYMHKQMQSLEQATTASSPTSSRQHPIYHPTPITDTQVAHARLHKAGHRPLG
RTQSAPLPLGHPMLQGGLMAPPTTTHYEDYLAEKQLHEQQQTHNYLKQQIRQTVLTRVGS
RSGQSAGQSQLLDEAPESEESEVIDLTGKKDNSGTSGGSSSAGSSSIEESEISKQQRDRE
QFLQQQRDLMMRHTLQAADTSAYPGRSSQSARPLSRALSSPLVHLGPQAAVAATDVYSRS
PRDQPTTGLAYDPLMLKHACACGEMRSHPEHGGRLQSVWARLSETGLLQRCDRVRSRKAT
LEEIQTCHTEAHALLFGTNPLTRHKLDMSKMQPSFVRLSCGGIGVDSDTTWNDIHTAPAA
RMAVGCVIELAFKAAMGDIKNGFAVVRPPGHHAEANLAMGFCFFNAVAIAAKLLLQKLDL
RKILILDWDVHHGNGTQQMFYDDPRVLYLSIHRHDDGNFFPGTGGPTECGAGEGMGRNVN
VAWSGGLNPPIGDAEYLAAFRTIVMPIAKDFDPDLVLVSAGFDAAHGHPAPLGGYKVSPA
CFGRMTQMLMTLAGGKVVLALEGGYDLTAICDSAQECVRALLGDEPTPIRDEELTRAPCQ
NAIDTLQKTIAIQMSHWPCVKHLAHTVDMSAIEASQKEHDETGTVSAMASLSMQQQNNLA
STPEHSREVSEEPMEQDEAK
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgatagtcatcgattctgatactactgattgtgtgacgaattctgttattctttgcttt
ttgcagctgtgggagcagcagaagcagctcgaggagcagcggagggaaaaggaacgactg
gaggccctcaggaagaaggacaagcatgaccacagtgctgtcgcctcgacggaggtcaag
caacgccttcaaagctttctggtgaacaagaagcagagggaggccgcggcagcggcgaac
ggagcagtgcccggcacacccggatacaggacctggttgcagtcgcagtcggactcgtcg
agctcgacgaccgcctctcacccctaccgaatgccgcagatcctgcaagagaaattcggc
gacgattttccactgaggaagacagcctcggagccgaatatgctgaaggtgcgacttaaa
caacgtgtcatggagaggaacatggcggcctcgagaaactcacccctaatggcacggcgg
aaggaccgactactgtcgcacctcaagcggaggtcactcctagcaaattctggtagtaat
ccggaatccgggcctaactcaccgccaacggtgggcaactcgcagtcgtcgccgacggcg
gccggaggcagtggaggcggcggctcgagtacgccgatccaggaggagagcgaagccgca
gcctacggtggtcagctcagcagtgccagccaacagggcagtctctccgacctgtccctc
ttcagctcgccgtccatgcccaacatctccctgggcagaccccatgtaccgtctagctcc
acgagcggttcgaagctggccacagtctccgaagccgaggtacgagcagcgttcaccgcg
cgtctgggcatgccgttgaccggccagatgcttccgggtacgctgccgttctacccctcg
ctgacggtgatcgacggcgagccaacctacatgcacaagcagatgcagagcctcgaacag
gcgacaaccgccagtagtccaaccagcagtaggcagcatccgatctatcatcctacgccc
ataaccgacacccaggtcgcacacgcgaggcttcataaggctggccaccggcctctaggt
aggacacagtcggcacctttacctctgggccacccaatgctgcagggcggtttgatggct
ccgccgacgacgacccactacgaggactacctcgcagagaagcagttgcacgagcaacag
cagacgcacaattacctcaagcagcaaattcgacagacagtccttacgcgggttggctcg
cgcagcggacaaagcgcaggacaatcccaacttctcgacgaggcacccgagtccgaggag
agcgaggtgatcgatctcaccggcaagaaggataattccgggacgagcggaggaagcagc
agcgccggtagcagcagcatagaggagagcgagatctcgaagcagcagcgggaccgcgaa
cagttcctccagcagcagcgcgacctcatgatgcgccatactctgcaggctgcggacacc
tcggcatacccaggcaggagctcgcagtcggctaggccgctttcgagggcgctctccagt
cctctggttcatttgggaccccaagctgctgtagcagcgaccgacgtgtactcgaggagt
ccacgcgatcaaccgactaccggactagcctatgacccactcatgctgaagcacgcgtgt
gcttgcggcgaaatgcgcagccatcctgagcatggtggtcgactacaaagcgtctgggcg
agactttccgagactgggcttctgcagcgttgtgacagagtacgctcacgcaaggctact
ctcgaggagatacaaacctgccacactgaggcccatgccctccttttcggcacgaatcca
cttacgcgccataagctggacatgtcaaagatgcagccgagctttgtgcgactatcttgt
ggcggcatcggcgtggacagcgacacaacgtggaacgatattcacacagcgccagcggca
cgtatggccgtcggttgcgttatcgagctcgcctttaaggcggcgatgggtgacatcaag
aacggcttcgcggttgtccggccacccggccatcacgctgaagccaatctagctatgggc
ttctgcttcttcaacgccgtcgctattgcggcaaaacttctgctccagaagcttgatcta
cgaaagatacttattttggattgggacgtacatcacggaaacggtacccagcagatgttc
tacgacgaccctcgggtgttgtacctgtcgatccacaggcacgacgacggtaactttttc
cccggcacaggcggtcccactgagtgcggtgccggtgaaggcatgggtcgtaacgtgaac
gttgcctggtcgggcggtttgaacccaccaataggcgatgccgagtacctcgcggccttc
cgcaccatcgtcatgcccatcgccaaagatttcgaccccgatctcgtcctcgtctcggcg
ggtttcgatgcggcacacggacacccagcacctcttggtggttacaaggtgtcgcctgcc
tgcttcggtcgcatgacccagatgctcatgaccctcgctggtggaaaggttgttcttgca
ctagagggtggttacgacctgacagccatctgcgactccgcgcaggagtgcgtcagggcg
ttgcttggagacgagccaacgccgatcagagatgaggaactcacaagggcgccctgccag
aatgccatcgatactttgcagaagaccattgctattcaaatgtcacactggccatgcgta
aagcacttggcgcatacagtagacatgagtgcaatcgaagcgagtcaaaaggaacacgac
gagactgggacagtctccgccatggcatctctttccatgcagcaacaaaacaaccttgca
agcacgccagaacattcccgcgaagtgtcggaagaaccgatggagcaggatgaggccaag
tga

DBGET integrated database retrieval system