KEGG   Nasonia vitripennis (jewel wasp): 100122308Help
Entry
100122308         CDS       T01081                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
Position
5
AA seq 961 aa AA seqDB search
MGQLWEQQKQLEEQRREKERLEALRKKDKHDHSAVASTEVKQRLQSFLVNKKQREAAAAA
NGAVPGTPGYRTWLQSQSDSSSSTTASHPYRMPQILQEKFGDDFPLRKTASEPNMLKVRL
KQRVMERNMAASRNSPLMARRKDRLLSHLKRRSLLANSGSNPESGPNSPPTVGNSQSSPT
AAGGSGGGGSSTPIQEESEAAAYGGQLSSASQQGSLSDLSLFSSPSMPNISLGRPHVPSS
STSGSKLATVSEAEVRAAFTARLGMPLTGQMLPGTLPFYPSLTVIDGEPTYMHKQMQSLE
QATTASSPTSSRQHPIYHPTPITDTQVAHARLHKAGHRPLGRTQSAPLPLGHPMLQGGLM
APPTTTHYEDYLAEKQLHEQQQTHNYLKQQIRQTVLTRVGSRSGQSAGQSQLLDEAPESE
ESEVIDLTGKKDNSGTSGGSSSAGSSSIEESEISKQQRDREQFLQQQRDLMMRHTLQAAD
TSAYPGRSSQSARPLSRALSSPLVHLGPQAAVAATDVYSRSPRDQPTTGLAYDPLMLKHA
CACGEMRSHPEHGGRLQSVWARLSETGLLQRCDRVRSRKATLEEIQTCHTEAHALLFGTN
PLTRHKLDMSKMQPSFVRLSCGGIGVDSDTTWNDIHTAPAARMAVGCVIELAFKAAMGDI
KNGFAVVRPPGHHAEANLAMGFCFFNAVAIAAKLLLQKLDLRKILILDWDVHHGNGTQQM
FYDDPRVLYLSIHRHDDGNFFPGTGGPTECGAGEGMGRNVNVAWSGGLNPPIGDAEYLAA
FRTIVMPIAKDFDPDLVLVSAGFDAAHGHPAPLGGYKVSPACFGRMTQMLMTLAGGKVVL
ALEGGYDLTAICDSAQECVRALLGDEPTPIRDEELTRAPCQNAIDTLQKTIAIQMSHWPC
VKHLAHTVDMSAIEASQKEHDETGTVSAMASLSMQQQNNLASTPEHSREVSEEPMEQDEA
K
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgggacagctgtgggagcagcagaagcagctcgaggagcagcggagggaaaaggaacga
ctggaggccctcaggaagaaggacaagcatgaccacagtgctgtcgcctcgacggaggtc
aagcaacgccttcaaagctttctggtgaacaagaagcagagggaggccgcggcagcggcg
aacggagcagtgcccggcacacccggatacaggacctggttgcagtcgcagtcggactcg
tcgagctcgacgaccgcctctcacccctaccgaatgccgcagatcctgcaagagaaattc
ggcgacgattttccactgaggaagacagcctcggagccgaatatgctgaaggtgcgactt
aaacaacgtgtcatggagaggaacatggcggcctcgagaaactcacccctaatggcacgg
cggaaggaccgactactgtcgcacctcaagcggaggtcactcctagcaaattctggtagt
aatccggaatccgggcctaactcaccgccaacggtgggcaactcgcagtcgtcgccgacg
gcggccggaggcagtggaggcggcggctcgagtacgccgatccaggaggagagcgaagcc
gcagcctacggtggtcagctcagcagtgccagccaacagggcagtctctccgacctgtcc
ctcttcagctcgccgtccatgcccaacatctccctgggcagaccccatgtaccgtctagc
tccacgagcggttcgaagctggccacagtctccgaagccgaggtacgagcagcgttcacc
gcgcgtctgggcatgccgttgaccggccagatgcttccgggtacgctgccgttctacccc
tcgctgacggtgatcgacggcgagccaacctacatgcacaagcagatgcagagcctcgaa
caggcgacaaccgccagtagtccaaccagcagtaggcagcatccgatctatcatcctacg
cccataaccgacacccaggtcgcacacgcgaggcttcataaggctggccaccggcctcta
ggtaggacacagtcggcacctttacctctgggccacccaatgctgcagggcggtttgatg
gctccgccgacgacgacccactacgaggactacctcgcagagaagcagttgcacgagcaa
cagcagacgcacaattacctcaagcagcaaattcgacagacagtccttacgcgggttggc
tcgcgcagcggacaaagcgcaggacaatcccaacttctcgacgaggcacccgagtccgag
gagagcgaggtgatcgatctcaccggcaagaaggataattccgggacgagcggaggaagc
agcagcgccggtagcagcagcatagaggagagcgagatctcgaagcagcagcgggaccgc
gaacagttcctccagcagcagcgcgacctcatgatgcgccatactctgcaggctgcggac
acctcggcatacccaggcaggagctcgcagtcggctaggccgctttcgagggcgctctcc
agtcctctggttcatttgggaccccaagctgctgtagcagcgaccgacgtgtactcgagg
agtccacgcgatcaaccgactaccggactagcctatgacccactcatgctgaagcacgcg
tgtgcttgcggcgaaatgcgcagccatcctgagcatggtggtcgactacaaagcgtctgg
gcgagactttccgagactgggcttctgcagcgttgtgacagagtacgctcacgcaaggct
actctcgaggagatacaaacctgccacactgaggcccatgccctccttttcggcacgaat
ccacttacgcgccataagctggacatgtcaaagatgcagccgagctttgtgcgactatct
tgtggcggcatcggcgtggacagcgacacaacgtggaacgatattcacacagcgccagcg
gcacgtatggccgtcggttgcgttatcgagctcgcctttaaggcggcgatgggtgacatc
aagaacggcttcgcggttgtccggccacccggccatcacgctgaagccaatctagctatg
ggcttctgcttcttcaacgccgtcgctattgcggcaaaacttctgctccagaagcttgat
ctacgaaagatacttattttggattgggacgtacatcacggaaacggtacccagcagatg
ttctacgacgaccctcgggtgttgtacctgtcgatccacaggcacgacgacggtaacttt
ttccccggcacaggcggtcccactgagtgcggtgccggtgaaggcatgggtcgtaacgtg
aacgttgcctggtcgggcggtttgaacccaccaataggcgatgccgagtacctcgcggcc
ttccgcaccatcgtcatgcccatcgccaaagatttcgaccccgatctcgtcctcgtctcg
gcgggtttcgatgcggcacacggacacccagcacctcttggtggttacaaggtgtcgcct
gcctgcttcggtcgcatgacccagatgctcatgaccctcgctggtggaaaggttgttctt
gcactagagggtggttacgacctgacagccatctgcgactccgcgcaggagtgcgtcagg
gcgttgcttggagacgagccaacgccgatcagagatgaggaactcacaagggcgccctgc
cagaatgccatcgatactttgcagaagaccattgctattcaaatgtcacactggccatgc
gtaaagcacttggcgcatacagtagacatgagtgcaatcgaagcgagtcaaaaggaacac
gacgagactgggacagtctccgccatggcatctctttccatgcagcaacaaaacaacctt
gcaagcacgccagaacattcccgcgaagtgtcggaagaaccgatggagcaggatgaggcc
aagtga

DBGET integrated database retrieval system